![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00019342001 | ||||||||
| Common Name | GSBRNA2T00019342001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 200aa MW: 22520.9 Da PI: 10.3744 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 170.5 | 5.1e-53 | 17 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90
lppGfrFhPtdeelvv+yLk kv++ +l++ +i evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk
GSBRNA2T00019342001 17 LPPGFRFHPTDEELVVHYLKSKVASAPLPV-AIIGEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDK 105
79****************************.88***************999999************************************ PP
NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
vl++ ++ +vg+kk Lvfy+g+ pkg+k+dW+mheyrl
GSBRNA2T00019342001 106 LVLASdGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 144
***9955667***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.32E-65 | 13 | 179 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 61.097 | 17 | 178 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.2E-28 | 18 | 144 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 200 aa Download sequence Send to blast |
MEITDSPGGS PPPQPNLPPG FRFHPTDEEL VVHYLKSKVA SAPLPVAIIG EVDLYKFDPW 60 ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKLVLAS DGKLKVGVKK 120 ALVFYSGKPP KGVKSDWIMH EYRLIDNKPN NRPPGCVFGN KRNSLRLDDW VLCRIYKKNN 180 ASRHKKSSLV IKWTPSQRL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 5e-73 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-73 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-73 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-73 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swm_B | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swm_C | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swm_D | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swp_A | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swp_B | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swp_C | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 3swp_D | 6e-73 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
| 4dul_A | 5e-73 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
| 4dul_B | 5e-73 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}. | |||||
| Uniprot | TISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00019342001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353226 | 1e-171 | AK353226.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-33-D23. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013626443.1 | 1e-131 | PREDICTED: NAC transcription factor 56-like | ||||
| Refseq | XP_022568598.1 | 1e-132 | NAC transcription factor 56-like | ||||
| Swissprot | Q9LD44 | 1e-112 | NAC56_ARATH; NAC transcription factor 56 | ||||
| TrEMBL | A0A078GBD0 | 1e-144 | A0A078GBD0_BRANA; BnaC08g43050D protein | ||||
| STRING | Bo3g066880.1 | 1e-131 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15510.1 | 1e-107 | NAC domain containing protein 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




