![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00019515001 | ||||||||
| Common Name | GSBRNA2T00019515001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 126aa MW: 14709.8 Da PI: 10.4413 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 44 | 5.3e-14 | 15 | 51 | 11 | 48 |
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
llv++v+ +G++ W+ Ia++++ gR +kqc++rw+++l
GSBRNA2T00019515001 15 LLVQLVEHHGTKKWSHIAKMLP-GRVGKQCRERWHNHL 51
69********************.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 58 | 99 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ W++eEd +l+ a+k+ G++ W+ Iar+++ gRt++ +k++w+
GSBRNA2T00019515001 58 DGWSEEEDMILIAAHKEIGNK-WAEIARKLP-GRTENTIKNHWN 99
56*******************.*********.***********8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.259 | 1 | 51 | IPR017930 | Myb domain |
| SMART | SM00717 | 9.9E-7 | 10 | 53 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-24 | 15 | 58 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 9.1E-16 | 15 | 65 | No hit | No description |
| CDD | cd00167 | 4.40E-10 | 15 | 51 | No hit | No description |
| SuperFamily | SSF46689 | 6.88E-29 | 31 | 110 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.592 | 52 | 106 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.4E-15 | 56 | 104 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-22 | 59 | 104 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.29E-11 | 60 | 102 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
DLIYKIFDDS TQFWLLVQLV EHHGTKKWSH IAKMLPGRVG KQCRERWHNH LRPDIKKDGW 60 SEEEDMILIA AHKEIGNKWA EIARKLPGRT ENTIKNHWNA TKRRQQSRRS KGKDETSLAI 120 CSSTL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 1e-39 | 16 | 105 | 15 | 104 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 6e-39 | 16 | 105 | 69 | 158 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 6e-39 | 16 | 105 | 69 | 158 | MYB PROTO-ONCOGENE PROTEIN |
| 1mse_C | 9e-40 | 16 | 105 | 15 | 104 | C-Myb DNA-Binding Domain |
| 1msf_C | 9e-40 | 16 | 105 | 15 | 104 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in embryos from the early heart stage and throughout embryogenesis (PubMed:18695688, PubMed:19066902). Induced at the onset of the maturation phase in the endosperm, in a high and homogeneous repartition (PubMed:18695688, PubMed:19066902, PubMed:25194028, PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in siliques (PubMed:18695688, PubMed:19066902). Also detected at low levels in leaves and flowers (PubMed:19066902). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00019515001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189633 | 2e-91 | AC189633.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS004A14, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018482289.1 | 1e-71 | PREDICTED: uncharacterized protein LOC108853370 | ||||
| Swissprot | Q9LVW4 | 8e-64 | MY118_ARATH; Transcription factor MYB118 | ||||
| TrEMBL | A0A078K1D9 | 2e-87 | A0A078K1D9_BRANA; BnaCnng73990D protein (Fragment) | ||||
| STRING | Bra025299.1-P | 4e-70 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6052 | 26 | 43 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27785.1 | 9e-59 | myb domain protein 118 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




