PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00020090001

Common Name

GSBRNA2T00020090001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

G2-like

Protein Properties

Length: 149aa MW: 16991.7 Da PI: 10.1921

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00020090001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	109.2	2.2e-34	16	70	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl GSBRNA2T00020090001 16 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 70 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.1E-33	13	71	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.801	13	73	IPR017930	Myb domain
SuperFamily	SSF46689	3.23E-17	15	71	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.6E-24	16	71	IPR006447	Myb domain, plants
Pfam	PF00249	5.7E-9	18	68	IPR001005	SANT/Myb domain
Pfam	PF14379	1.3E-6	120	136	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVAQLGGPD KATPKTIMRV MGVKGLTLYH 60 LKSHLQKFRL GKQPHKEYGD QSTKEGSRAS AMDIQRNIAS SSGMISRNMN DSNLHLVYLI 120 RMQMEVQRRL HEQLEVVNFF IFYNIHLL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	1e-20	16	72	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	1e-20	16	72	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	1e-20	16	72	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	1e-20	16	72	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:18523061}.
Uniprot	TISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:15923329, ECO:0000269\|PubMed:26239308}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:18523061, ECO:0000269\|PubMed:25081480, ECO:0000269\|PubMed:26239308, ECO:0000305\|PubMed:15592750}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00020090001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269\|PubMed:15592750}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK316719	1e-146	AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013726973.1	2e-83	myb family transcription factor APL
Swissprot	Q9SAK5	7e-83	APL_ARATH; Myb family transcription factor APL
TrEMBL	A0A078J370	1e-107	A0A078J370_BRANA; BnaA02g36130D protein
STRING	Bo6g123880.1	6e-83	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5044	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79430.2	3e-85	G2-like family protein

Publications ? help Back to Top
Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R Vascular gene expression: a hypothesis. Front Plant Sci, 2013. 4: p. 261 [PMID:23882276] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Kondo Y, et al. Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells. Plant Cell, 2016. 28(6): p. 1250-62 [PMID:27194709] Shibuta M,Abe M FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells. Plant Cell Physiol., 2017. 58(11): p. 2017-2025 [PMID:29036620]