![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00025227001 | ||||||||
| Common Name | GSBRNA2T00025227001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 185aa MW: 20875.3 Da PI: 9.0432 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 128 | 1.3e-39 | 64 | 181 | 5 | 118 |
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee.......lleelkveeenlksnve 87
s seq+CyvqCn+C+tilavsvP+ts+fk+vtvrCG+Ct+l+s ++++s +l+a+++l+ +l ++ +leelk++ +n++++++
GSBRNA2T00025227001 64 SPSEQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLIS--VNMRSLVLPASNQLQLQLGPHsyftpqnILEELKDAPSNMNMMMM 151
789****************************************..5678999************************************** PP
YABBY 88 keesastsvsseklsenedeevprvppvirP 118
+++ ++++++s+ ++ ++++e+p++ppv+r
GSBRNA2T00025227001 152 NQDPNMNDIPSF-MDLHQQHEIPKAPPVNRR 181
***********6.5**************994 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 3.0E-27 | 65 | 182 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 185 aa Download sequence Send to blast |
KSSFNKKVIK YPSINQIPKH SKKERISFQL QSLFLLLTKM SMSSMSSPSS AVFSPENLSP 60 DPLSPSEQLC YVQCNYCETI LAVSVPYTSM FKTVTVRCGC CTNLISVNMR SLVLPASNQL 120 QLQLGPHSYF TPQNILEELK DAPSNMNMMM MNQDPNMNDI PSFMDLHQQH EIPKAPPVNR 180 RKRQ* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.17602 | 0.0 | flower| seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo the expression starts during the transition between globular and heart stages in the cotyledon anlagen. From the heart stage, expression expands to abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in abaxial regions of young lateral aerial organs, and in primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:14555697, ECO:0000269|Ref.3}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00025227001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ234917 | 0.0 | JQ234917.1 Brassica rapa subsp. pekinensis clone 3-702 putative male sterile protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009142322.1 | 1e-101 | PREDICTED: axial regulator YABBY 1 isoform X2 | ||||
| Refseq | XP_013688136.1 | 1e-101 | axial regulator YABBY 1-like isoform X2 | ||||
| Refseq | XP_022557317.1 | 1e-100 | axial regulator YABBY 1-like isoform X2 | ||||
| Refseq | XP_022557318.1 | 1e-100 | axial regulator YABBY 1-like isoform X2 | ||||
| Swissprot | O22152 | 9e-70 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
| TrEMBL | A0A078JWX3 | 1e-131 | A0A078JWX3_BRANA; BnaAnng40070D protein (Fragment) | ||||
| STRING | Bostr.25993s0255.1.p | 6e-79 | (Boechera stricta) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45190.1 | 3e-67 | YABBY family protein | ||||




