PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00025227001

Common Name

GSBRNA2T00025227001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

YABBY

Protein Properties

Length: 185aa MW: 20875.3 Da PI: 9.0432

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00025227001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	128	1.3e-39	64	181	5	118
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee.......lleelkveeenlksnve 87 s seq+CyvqCn+C+tilavsvP+ts+fk+vtvrCG+Ct+l+s ++++s +l+a+++l+ +l ++ +leelk++ +n++++++ GSBRNA2T00025227001 64 SPSEQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLIS--VNMRSLVLPASNQLQLQLGPHsyftpqnILEELKDAPSNMNMMMM 151 789**************************************..5678999********************************** PP YABBY 88 keesastsvsseklsenedeevprvppvirP 118 +++ ++++++s+ ++ ++++e+p++ppv+r GSBRNA2T00025227001 152 NQDPNMNDIPSF-MDLHQQHEIPKAPPVNRR 181 *******6.5************994 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	3.0E-27	65	182	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
KSSFNKKVIK YPSINQIPKH SKKERISFQL QSLFLLLTKM SMSSMSSPSS AVFSPENLSP 60 DPLSPSEQLC YVQCNYCETI LAVSVPYTSM FKTVTVRCGC CTNLISVNMR SLVLPASNQL 120 QLQLGPHSYF TPQNILEELK DAPSNMNMMM MNQDPNMNDI PSFMDLHQQH EIPKAPPVNR 180 RKRQ*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.17602	0.0	flower\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo the expression starts during the transition between globular and heart stages in the cotyledon anlagen. From the heart stage, expression expands to abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed in abaxial regions of young lateral aerial organs, and in primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:14555697, ECO:0000269\|Ref.3}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00025227001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ234917	0.0	JQ234917.1 Brassica rapa subsp. pekinensis clone 3-702 putative male sterile protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009142322.1	1e-101	PREDICTED: axial regulator YABBY 1 isoform X2
Refseq	XP_013688136.1	1e-101	axial regulator YABBY 1-like isoform X2
Refseq	XP_022557317.1	1e-100	axial regulator YABBY 1-like isoform X2
Refseq	XP_022557318.1	1e-100	axial regulator YABBY 1-like isoform X2
Swissprot	O22152	9e-70	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A078JWX3	1e-131	A0A078JWX3_BRANA; BnaAnng40070D protein (Fragment)
STRING	Bostr.25993s0255.1.p	6e-79	(Boechera stricta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	3e-67	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]