![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00027140001 | ||||||||
| Common Name | GSBRNA2T00027140001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 65aa MW: 7414.9 Da PI: 10.4389 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 50.4 | 2.9e-16 | 11 | 53 | 3 | 45 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
ie ++ +skR++g+lKKAeE+ +LCd ++ +++fs+t k
GSBRNA2T00027140001 11 IECPKEKSSKYSKRKKGLLKKAEEMAILCDSDIILLVFSPTSK 53
6666677888*****************************9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.09E-19 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 20.633 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 5.3E-22 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 9.96E-13 | 2 | 59 | No hit | No description |
| PRINTS | PR00404 | 2.9E-14 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.8E-16 | 11 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-14 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-14 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MGRKKIELKT IECPKEKSSK YSKRKKGLLK KAEEMAILCD SDIILLVFSP TSKPNLFYPH 60 SRLF* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00027140001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC237304 | 1e-78 | AC237304.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006I08, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022563677.1 | 2e-37 | agamous-like MADS-box protein AGL65 | ||||
| Swissprot | Q7X9I0 | 2e-13 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
| TrEMBL | A0A078GDW4 | 9e-38 | A0A078GDW4_BRANA; BnaC04g13450D protein | ||||
| STRING | Bo8g098790.1 | 7e-35 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7330 | 18 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26320.1 | 1e-11 | AGAMOUS-like 33 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




