![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00028222001 | ||||||||
| Common Name | GSBRNA2T00028218001, GSBRNA2T00028222001, LOC106374496, LOC106376140 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 79aa MW: 9531.94 Da PI: 9.6871 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.6 | 1.2e-07 | 25 | 64 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++++E++l+++ ++ G + W+ Ia +++ gR + ++ +w
GSBRNA2T00028222001 25 MSQQEEDLILRMYRLVGDR-WEIIAGRVP-GRKAVEIERYWI 64
799**************99.*********.***********5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 5.4E-6 | 21 | 69 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.15E-5 | 24 | 63 | No hit | No description |
| Pfam | PF00249 | 6.6E-7 | 25 | 64 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.26E-7 | 26 | 64 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-9 | 26 | 64 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MDSTYRRQRH NSEEVCSVKW DFIKMSQQEE DLILRMYRLV GDRWEIIAGR VPGRKAVEIE 60 RYWIMRNNTH FLPPSSKF* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00028222001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189566 | 7e-50 | AC189566.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH009D02, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013587526.1 | 4e-53 | PREDICTED: transcription factor TRY-like | ||||
| Refseq | XP_013669961.1 | 4e-53 | transcription factor TRY-like | ||||
| Refseq | XP_013671656.1 | 4e-53 | transcription factor TRY-like | ||||
| Swissprot | Q8GV05 | 2e-30 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A078J2S4 | 9e-52 | A0A078J2S4_BRANA; BnaCnng35720D protein | ||||
| STRING | Bra026297.1-P | 3e-32 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 6e-33 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106374496 | 106376140 |




