PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00033573001

Common Name

GSBRNA2T00033573001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 162aa MW: 18460.2 Da PI: 9.9553

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00033573001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	166.3	1.1e-51	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk GSBRNA2T00033573001 14 LPPGFRFYPTDEELMVQYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDK 102 79*************************9.89***********8888899*****************************99 PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl GSBRNA2T00033573001 103 IIST-EGKRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139 9988.9999*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.14E-60	9	147	IPR003441	NAC domain
PROSITE profile	PS51005	53.445	14	161	IPR003441	NAC domain
Pfam	PF02365	2.2E-26	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MGIQETDPLA QLSLPPGFRF YPTDEELMVQ YLCRKAAGYD FSLQLIAEID LYKFDPWVLP 60 NKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGKR VGIKKALVFY 120 IGKAPKGTKT NWIMHEYRLL EPSRANGSSK VTIQHANYLK N*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	1e-108	1	151	7	157	NAC domain-containing protein 19
3swm_B	1e-108	1	151	7	157	NAC domain-containing protein 19
3swm_C	1e-108	1	151	7	157	NAC domain-containing protein 19
3swm_D	1e-108	1	151	7	157	NAC domain-containing protein 19
3swp_A	1e-108	1	151	7	157	NAC domain-containing protein 19
3swp_B	1e-108	1	151	7	157	NAC domain-containing protein 19
3swp_C	1e-108	1	151	7	157	NAC domain-containing protein 19
3swp_D	1e-108	1	151	7	157	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.11196	0.0	bud\| leaf\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stems, flowers, cauline leaves and rosettes. {ECO:0000269\|PubMed:12646039, ECO:0000269\|PubMed:15319476}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269\|PubMed:15319476}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00033573001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269\|PubMed:12646039, ECO:0000269\|PubMed:15319476}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966747	0.0	KC966747.1 Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013588383.1	1e-109	PREDICTED: NAC domain-containing protein 19
Refseq	XP_013703003.1	1e-109	NAC domain-containing protein 19
Swissprot	Q9C932	1e-106	NAC19_ARATH; NAC domain-containing protein 19
TrEMBL	A0A078GLM6	1e-117	A0A078GLM6_BRANA; BnaC06g05920D protein
STRING	Bra018998.1-P	1e-107	(Brassica rapa)
STRING	Bo6g030940.1	1e-108	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1435	27	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G52890.1	1e-109	NAC domain containing protein 19

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng XY, et al. Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation. Cell Host Microbe, 2012. 11(6): p. 587-96 [PMID:22704619] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guan Q,Yue X,Zeng H,Zhu J The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis. Plant Cell, 2014. 26(1): p. 438-53 [PMID:24415771] Chen F, et al. Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways. Plant Cell, 2014. 26(5): p. 1949-1966 [PMID:24794133] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Zhu X, et al. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes. Plant J., 2015. 84(3): p. 597-610 [PMID:26407000] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Gimenez-Ibanez S, et al. JAZ2 controls stomata dynamics during bacterial invasion. New Phytol., 2017. 213(3): p. 1378-1392 [PMID:28005270] Ueda M, et al. The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response. Plant Physiol., 2017. 175(4): p. 1760-1773 [PMID:29018096] Kang M, et al. The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain. Cell Rep, 2018. 22(5): p. 1141-1150 [PMID:29386103] Sukiran NL,Ma JC,Ma H,Su Z ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 161-174 [PMID:30604322]