PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00033834001

Common Name

GSBRNA2T00033834001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

LFY

Protein Properties

Length: 290aa MW: 31872.6 Da PI: 5.4453

Description

LFY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00033834001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	FLO_LFY	354.7	1.7e-108	1	288	1	284
FLO_LFY 1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 mdpe f++ lf+w+p a++++p+ ++ ++++p++ ++aa ++l +le lf yGvr++t+akiaelGft+stLv+mkdeel+d+m GSBRNA2T00033834001 1 MDPEGFTSGLFRWNPTRAMVQQPSPPVPPPPQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMM 90 9***********77676666666666666677777788888888899************************************* PP FLO_LFY 91 kslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqe..ekeaagsggeglgea 171 +sls+ifr++llvGeryG+kaavraerrrl e e+++++rr+l+ + +++aldalsqeglseepv++ +++aag++g+g g + GSBRNA2T00033834001 91 NSLSHIFRWELLVGERYGVKAAVRAERRRLLEeeEQESSRRRHLIlsaagDSGTHHALDALSQEGLSEEPVHQleHTDAAGNNGGGGGYW 180 *************************976334445677777778844344556***********9963333666777776677 PP FLO_LFY 172 elvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge....erqrehPfivtepgevargkknGLDYLfdLye 257 ++ +a+ kk + +++++k++ + + e+d+d +e +d+d+ ++g +g erqrehPfivtepgevargkknGLDYLf+Lye GSBRNA2T00033834001 181 DAGQAK------MKKPQ--QRRRKKQMVT-SVETDDDMNEGDDDDDGNGGGGGGvlgiERQREHPFIVTEPGEVARGKKNGLDYLFHLYE 261 665444......22222..2333333333.3344444444444444433333223555**************************** PP FLO_LFY 258 qCrefLlqvqkiakerGekcPtkvtnq 284 qCrefL+qvq+iak+rGekcPtkv + GSBRNA2T00033834001 262 QCREFLIQVQTIAKDRGEKCPTKVSSK 288 **********************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF01698	2.1E-116	1	288	IPR002910	Floricaula/leafy protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 290 aa Download sequence Send to blast
MDPEGFTSGL FRWNPTRAMV QQPSPPVPPP PQQQPPATPQ TAAFGMRLGG LEGLFGPYGV 60 RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGVK AAVRAERRRL 120 LEEEEQESSR RRHLILSAAG DSGTHHALDA LSQEGLSEEP VHQLEHTDAA GNNGGGGGYW 180 DAGQAKMKKP QQRRRKKQMV TSVETDDDMN EGDDDDDGNG GGGGGVLGIE RQREHPFIVT 240 EPGEVARGKK NGLDYLFHLY EQCREFLIQV QTIAKDRGEK CPTKVSSKI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2vy1_A	7e-35	227	289	1	63	PROTEIN LEAFY
2vy2_A	7e-35	227	289	1	63	PROTEIN LEAFY
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	189	197	PQQRRRKKQ

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at an early stage of floral initiation.
Uniprot	TISSUE SPECIFICITY: Expressed uniformly throughout the young floral primordia.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1. Is required subsequently for the transition of an inflorescence meristem into a floral meristem, by an immediate upstream regulation of the ABC classes of floral homeotic genes. Activates directly APETALA1, CAULIFLOWER and AGAMOUS, and indirectly APETALA3 and PISTILLATA with the cooperation of UFO. {ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9783581, ECO:0000269\|Ref.6}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00033834001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by CAULIFLOWER and APETALA1. Down-regulated by TFL1.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HQ615937	0.0	HQ615937.1 Brassica rapa LEAFYa (LFYa) mRNA, complete cds.
GenBank	KR190435	0.0	KR190435.1 Brassica rapa subsp. pekinensis leafy 1 (LFY1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001288996.1	0.0	protein LEAFY
Swissprot	Q00958	1e-133	LFY_ARATH; Protein LEAFY
TrEMBL	A0A078K3W7	0.0	A0A078K3W7_BRANA; BnaCnng78500D protein
STRING	Bra029305.1-P	0.0	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7907	28	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G61850.1	1e-119	floral meristem identity control protein LEAFY (LFY)

Publications ? help Back to Top
Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula). PLoS ONE, 2012. 7(8): p. e42839 [PMID:22916167] Yang C, et al. VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis. Curr. Biol., 2013. 23(14): p. 1324-9 [PMID:23810531] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Niwa M,Endo M,Araki T Florigen is involved in axillary bud development at multiple stages in Arabidopsis. Plant Signal Behav, 2013. 8(11): p. e27167 [PMID:24305631] Fu J, et al. Photoperiodic control of FT-like gene ClFT initiates flowering in Chrysanthemum lavandulifolium. Plant Physiol. Biochem., 2014. 74: p. 230-8 [PMID:24316581] Risseeuw E, et al. An activated form of UFO alters leaf development and produces ectopic floral and inflorescence meristems. PLoS ONE, 2013. 8(12): p. e83807 [PMID:24376756] Yang Z, et al. Analyses of sequence polymorphism and haplotype diversity of LEAFY genes revealed post-domestication selection in the Chinese elite maize inbred lines. Mol. Biol. Rep., 2014. 41(2): p. 1117-25 [PMID:24381105] Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Yamaguchi N, et al. Gibberellin acts positively then negatively to control onset of flower formation in Arabidopsis. Science, 2014. 344(6184): p. 638-41 [PMID:24812402] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Leal Valentim F, et al. A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network. PLoS ONE, 2015. 10(2): p. e0116973 [PMID:25719734] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Kusters E,Della Pina S,Castel R,Souer E,Koes R Changes in cis-regulatory elements of a key floral regulator are associated with divergence of inflorescence architectures. Development, 2015. 142(16): p. 2822-31 [PMID:26220938] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Yamaguchi N,Jeong CW,Nole-Wilson S,Krizek BA,Wagner D AINTEGUMENTA and AINTEGUMENTA-LIKE6/PLETHORA3 Induce LEAFY Expression in Response to Auxin to Promote the Onset of Flower Formation in Arabidopsis. Plant Physiol., 2016. 170(1): p. 283-93 [PMID:26537561] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Fu X, et al. CHD3 chromatin-remodeling factor PICKLE regulates floral transition partially via modulating LEAFY expression at the chromatin level in Arabidopsis. Sci China Life Sci, 2016. 59(5): p. 516-28 [PMID:27056257] Yamaguchi N,Wu MF,Winter CM,Wagner D LEAFY and Polar Auxin Transport Coordinately Regulate Arabidopsis Flower Development. Plants (Basel), 2014. 3(2): p. 251-65 [PMID:27135503] Xu C,Yu Y,Zhang Y,Li Y,Wei S Gibberellins are involved in effect of near-null magnetic field on Arabidopsis flowering. Bioelectromagnetics, 2017. 38(1): p. 1-10 [PMID:27598690] Tang M, et al. An ortholog of LEAFY in Jatropha curcas regulates flowering time and floral organ development. Sci Rep, 2016. 6: p. 37306 [PMID:27869146] Wendell M, et al. Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern. Plant Cell Physiol., 2017. 58(3): p. 466-477 [PMID:28028164] Monniaux M, et al. Conservation vs divergence in LEAFY and APETALA1 functions between Arabidopsis thaliana and Cardamine hirsuta. New Phytol., 2017. 216(2): p. 549-561 [PMID:28098947] Guo WY,Cui YM,Wang TT,Yu DY,Huang F Functional analysis of flower development related gene GsLFY from Glycine soja. Yi Chuan, 2017. 39(1): p. 56-65 [PMID:28115306] Dhakate P,Tyagi S,Singh A,Singh A Functional characterization of a novel Brassica LEAFY homolog from Indian mustard: Expression pattern and gain-of-function studies. Plant Sci., 2017. 258: p. 29-44 [PMID:28330561] Yang T,Du MF,Guo YH,Liu X Two LEAFY homologs ILFY1 and ILFY2 control reproductive and vegetative developments in Isoetes L. Sci Rep, 2017. 7(1): p. 225 [PMID:28331204] Goslin K, et al. Transcription Factor Interplay between LEAFY and APETALA1/CAULIFLOWER during Floral Initiation. Plant Physiol., 2017. 174(2): p. 1097-1109 [PMID:28385730] Serrano-Mislata A, et al. Regulatory interplay between LEAFY, APETALA1/CAULIFLOWER and TERMINAL FLOWER1: New insights into an old relationship. Plant Signal Behav, 2017. 12(10): p. e1370164 [PMID:28873010] Zhang GZ, et al. Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis. Plant Cell Rep., 2017. 36(12): p. 1995-2006 [PMID:29027578] Zhao W, et al. CsLFY is required for shoot meristem maintenance via interaction with WUSCHEL in cucumber (Cucumis sativus). New Phytol., 2018. 218(1): p. 344-356 [PMID:29274285] Dotto M,Gómez MS,Soto MS,Casati P UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. Plant Cell Environ., 2018. 41(6): p. 1394-1406 [PMID:29447428] Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana. Plant Cell Rep., 2018. 37(6): p. 901-912 [PMID:29541883]