PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00034374001

Common Name

GSBRNA2T00034374001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

CAMTA

Protein Properties

Length: 113aa MW: 13420.2 Da PI: 6.7923

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00034374001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	126.5	1.1e-39	34	111	41	118
CG-1 41 LynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118 L + +++ryfrkDG++w++kkdgktv+E+hekLKvg+++vl+cyYah e+n++fqrrcyw+Le+el ++v+++ylevk GSBRNA2T00034374001 34 LHSFQVLRYFRKDGHNWRNKKDGKTVKEAHEKLKVGSIDVLHCYYAHEEDNENFQRRCYWMLEQELMHVVFIQYLEVK 111 556689*********************************************************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	49.742	1	112	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	6.5E-36	5	111	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.0E-32	36	110	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MVDVLRTPSS DSSLLIRFND STDFDELTKP VSPLHSFQVL RYFRKDGHNW RNKKDGKTVK 60 EAHEKLKVGS IDVLHCYYAH EEDNENFQRR CYWMLEQELM HVVFIQYLEV KV*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, old leaves, petals, sepals, top of carpels, stigmas, stamen filaments, anthers and siliques, but not in pollen. {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:14581622}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00034374001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493811	1e-70	AB493811.1 Arabidopsis thaliana At5g64220 mRNA for hypothetical protein, partial cds, clone: RAAt5g64220.
GenBank	AK229403	1e-70	AK229403.1 Arabidopsis thaliana mRNA for Calmodulin-binding transcription activator 2, complete cds, clone: RAFL16-66-C08.
GenBank	BT010874	1e-70	BT010874.1 Arabidopsis thaliana At5g64220 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013616703.1	8e-52	PREDICTED: uncharacterized protein LOC106323081 isoform X2
Swissprot	Q6NPP4	4e-44	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A078JC46	1e-78	A0A078JC46_BRANA; BnaC02g46140D protein
STRING	XP_010444355.1	1e-42	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM19280	4	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	2e-46	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]