![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00037593001 | ||||||||
| Common Name | GSBRNA2T00037593001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 159aa MW: 18261.6 Da PI: 7.6359 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 24.9 | 5.6e-08 | 10 | 54 | 2 | 44 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikev.diykveP 44
pGfr hPtdeel+++yLk ++ ++l+ ++ i+++ +i ++ P
GSBRNA2T00037593001 10 SPGFRLHPTDEELLHYYLKTRILPTSLRWKTNgISSAkRIENTRP 54
69*******************999887765555666655666666 PP
| |||||||
| 2 | NAM | 70.6 | 4e-22 | 54 | 113 | 69 | 129 |
NAM 69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
+ + ++ rat++g+Wkatg+dk + + + +++g++ktLvfyk ra++g+ktdW+mheyrle
GSBRNA2T00037593001 54 PGQGQTVRATHEGFWKATGRDKCIRN-SYQKIGMRKTLVFYKRRAHHGQKTDWIMHEYRLE 113
4566899******************9.9999****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 22.873 | 1 | 134 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.26E-31 | 8 | 129 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.7E-19 | 11 | 112 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MDLSSNGGVS PGFRLHPTDE ELLHYYLKTR ILPTSLRWKT NGISSAKRIE NTRPGQGQTV 60 RATHEGFWKA TGRDKCIRNS YQKIGMRKTL VFYKRRAHHG QKTDWIMHEY RLEDADDPQR 120 NPSMDWVACE DVFSEVIIDV IADVDDVLNG ENHMDARC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swm_B | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swm_C | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swm_D | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swp_A | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swp_B | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swp_C | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| 3swp_D | 4e-19 | 9 | 129 | 20 | 163 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Detectable in lateral root development when they reach 10 mm long. {ECO:0000269|PubMed:20197506}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed throughout the root cap, in both columella (COL) and lateral root cap (LRC) cells, with higher levels in the COL-adjoining LRC than the upper LRC. Also present at low levels expression in the tips of cotyledons and the cotyledon vasculature, as weel as in vasculature of the first pair of true leaves and at the hydathodes. {ECO:0000269|PubMed:20197506}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00037593001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_192773.1 | 8e-52 | NAC domain containing protein 70 | ||||
| Refseq | XP_018456850.1 | 9e-52 | PREDICTED: protein BEARSKIN2-like | ||||
| Refseq | XP_018456855.1 | 9e-52 | PREDICTED: protein BEARSKIN2-like | ||||
| Swissprot | Q9SV87 | 7e-53 | BRN2_ARATH; Protein BEARSKIN2 | ||||
| TrEMBL | A0A078JDW6 | 1e-116 | A0A078JDW6_BRANA; BnaCnng40940D protein | ||||
| STRING | Bo2g110370.1 | 1e-115 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G10350.1 | 1e-53 | NAC domain containing protein 70 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




