![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00044503001 | ||||||||
| Common Name | GSBRNA2T00044503001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 173aa MW: 19723.7 Da PI: 9.5016 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 174.9 | 2.3e-54 | 20 | 146 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90
lppGfrFhPtd e++ +yLk+kv + +++ +i ++d++k ePwdLpk +k +eke yfF++rd+ky+tg r+nrat sgyWkatgkdk
GSBRNA2T00044503001 20 LPPGFRFHPTDAEIIIHYLKEKVFNVRFTS-AAIGQADLNKNEPWDLPKIAKMGEKEFYFFCQRDRKYPTGMRTNRATVSGYWKATGKDK 108
79*************************999.78***************8888899*********************************** PP
NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
e+++ kg lvg+kktLvfy+grapkgekt+Wvmheyrl
GSBRNA2T00044503001 109 EIFRGKGCLVGMKKTLVFYRGRAPKGEKTNWVMHEYRL 146
****9*******************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 5.75E-57 | 16 | 150 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 51.357 | 20 | 167 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.8E-28 | 21 | 146 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MLEEGGVVVN QGGDQEMVDL PPGFRFHPTD AEIIIHYLKE KVFNVRFTSA AIGQADLNKN 60 EPWDLPKIAK MGEKEFYFFC QRDRKYPTGM RTNRATVSGY WKATGKDKEI FRGKGCLVGM 120 KKTLVFYRGR APKGEKTNWV MHEYRLDGIY SYHNLPKTAS VCNSTIFTEL LV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 6e-48 | 18 | 146 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 6e-48 | 18 | 146 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 6e-48 | 18 | 146 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 6e-48 | 18 | 146 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 7e-48 | 18 | 146 | 18 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 6e-48 | 18 | 146 | 15 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 6e-48 | 18 | 146 | 15 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00044503001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF361623 | 0.0 | AF361623.1 Arabidopsis thaliana AT3g04060/T11I18_17 mRNA, complete cds. | |||
| GenBank | AY081834 | 0.0 | AY081834.1 Arabidopsis thaliana AT3g04060/T11I18_17 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013639829.1 | 1e-118 | PREDICTED: NAC domain-containing protein 100-like | ||||
| Refseq | XP_013742263.2 | 1e-118 | NAC domain-containing protein 79-like | ||||
| Swissprot | Q9SQQ6 | 1e-112 | NAC46_ARATH; NAC domain-containing protein 46 | ||||
| TrEMBL | A0A078GXM6 | 1e-127 | A0A078GXM6_BRANA; BnaC01g40260D protein | ||||
| STRING | Bo1g152230.1 | 1e-117 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2269 | 27 | 75 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04060.1 | 1e-115 | NAC domain containing protein 46 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




