![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00045092001 | ||||||||
| Common Name | GSBRNA2T00045092001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 82aa MW: 9205.57 Da PI: 10.2437 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 37.2 | 9.8e-12 | 14 | 71 | 2 | 59 |
FAR1 2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetr 59
fY++Y++++GF +r+ + ++s+r+g+i r+f C+keg+ + + k+ + r++r++tr
GSBRNA2T00045092001 14 FYDDYSRSLGFVMRVMSCRRSERDGRILARRFGCNKEGRCVSVRGKSGSVRKPRQSTR 71
9*************************************99988888788888888887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 2.2E-9 | 14 | 71 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MAVEFESEDA AKMFYDDYSR SLGFVMRVMS CRRSERDGRI LARRFGCNKE GRCVSVRGKS 60 GSVRKPRQST RGGLVRLCDS C* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.11624 | 8e-94 | seed | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00045092001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022572523.1 | 1e-47 | O-acyltransferase WSD1-like isoform X1 | ||||
| Refseq | XP_022572524.1 | 1e-47 | O-acyltransferase WSD1-like isoform X2 | ||||
| TrEMBL | A0A078GY17 | 5e-50 | A0A078GY17_BRANA; BnaA04g24970D protein | ||||
| TrEMBL | M4F9G1 | 5e-50 | M4F9G1_BRARP; Uncharacterized protein | ||||
| STRING | Bra037724.1-P | 8e-51 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3918 | 28 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G43280.1 | 2e-41 | FAR1 family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




