![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00048692001 | ||||||||
| Common Name | GSBRNA2T00048692001, GSBRNA2T00072693001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 70aa MW: 7825.1 Da PI: 10.5644 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 96.8 | 9.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++ klye+ss
GSBRNA2T00048692001 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPSSKLYEFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.413 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.94E-38 | 3 | 66 | No hit | No description |
| PRINTS | PR00404 | 6.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.49E-30 | 3 | 65 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP SSKLYEFSSS 60 GQERLITIN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 9e-20 | 3 | 66 | 2 | 65 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 9e-20 | 3 | 66 | 2 | 65 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 9e-20 | 3 | 66 | 2 | 65 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 9e-20 | 3 | 66 | 2 | 65 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_B | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_C | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_D | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_A | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_B | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_C | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_D | 1e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00048692001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK230464 | 7e-62 | AK230464.1 Arabidopsis thaliana mRNA for MADS-box protein AGL14, complete cds, clone: RAFL26-03-G06. | |||
| GenBank | AL078606 | 7e-62 | AL078606.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T26M18 (ESSA project). | |||
| GenBank | AL161532 | 7e-62 | AL161532.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 32. | |||
| GenBank | AL161533 | 7e-62 | AL161533.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 33. | |||
| GenBank | CP002687 | 7e-62 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018444499.1 | 5e-36 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
| Refseq | XP_022549659.1 | 1e-36 | agamous-like MADS-box protein AGL19 | ||||
| Swissprot | O82743 | 6e-35 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
| TrEMBL | A0A078HWX3 | 5e-42 | A0A078HWX3_BRANA; BnaA01g12710D protein | ||||
| STRING | Bo1g031900.1 | 3e-35 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G22950.1 | 3e-37 | AGAMOUS-like 19 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




