![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00051887001 | ||||||||
| Common Name | GSBRNA2T00051887001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 95aa MW: 11170.6 Da PI: 8.6513 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 50 | 5e-16 | 3 | 40 | 17 | 54 |
HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
++F ++++p++++r +L++klgL rqVk+WFqNrR++
GSBRNA2T00051887001 3 TYFSECQHPDKKQRMQLSRKLGLVPRQVKFWFQNRRIQ 40
69**********************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 5.0E-4 | 1 | 48 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 14.252 | 1 | 44 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 9.61E-13 | 3 | 43 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 1.7E-13 | 3 | 40 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-14 | 4 | 47 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.56E-10 | 4 | 38 | No hit | No description |
| PRINTS | PR00031 | 3.1E-5 | 15 | 24 | IPR000047 | Helix-turn-helix motif |
| PRINTS | PR00031 | 3.1E-5 | 24 | 40 | IPR000047 | Helix-turn-helix motif |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MLTYFSECQH PDKKQRMQLS RKLGLVPRQV KFWFQNRRIQ KAQQERADSS ALKEESDRIR 60 CENTAIREAY EHTICHNCGD APVHDNSYFD AQKL* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in all cells at the 4- and 16-cell embryo stages. Expression is restricted to the protoderm from the globular stage onward. {ECO:0000269|PubMed:25564655}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and stamen filament epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269|PubMed:16778018}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that acts as negative regulator of trichome branching in association with HDG11 (PubMed:16778018). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). Acts as positive regulator of SCL18/LAS expression (PubMed:25358340). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:25358340, ECO:0000269|PubMed:25564655}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00051887001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013587672.1 | 7e-53 | PREDICTED: homeobox-leucine zipper protein HDG12-like | ||||
| Swissprot | Q9LMT8 | 1e-42 | HDG12_ARATH; Homeobox-leucine zipper protein HDG12 | ||||
| TrEMBL | A0A078H4N3 | 3e-65 | A0A078H4N3_BRANA; BnaC01g36780D protein | ||||
| TrEMBL | A0A0D3ADM9 | 3e-65 | A0A0D3ADM9_BRAOL; Uncharacterized protein | ||||
| STRING | Bo1g131210.1 | 5e-66 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17003 | 6 | 11 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17920.1 | 6e-45 | homeodomain GLABROUS 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




