PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00056572001

Common Name

GSBRNA2T00056572001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 153aa MW: 17118.5 Da PI: 4.7875

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00056572001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	32	2.9e-10	98	140	3	46
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 W+++++ ll+++ +++G+g+ + +a+++g ++ +qc +++++ GSBRNA2T00056572001 98 DWSADDEMLLLEGLEMYGMGNMTEVAEYVG-SKSKEQCLEHYRN 140 5***************************.*********99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00291	4.5E-10	35	80	IPR000433	Zinc finger, ZZ-type
PROSITE profile	PS50135	10.317	35	82	IPR000433	Zinc finger, ZZ-type
Pfam	PF00569	7.4E-8	38	79	IPR000433	Zinc finger, ZZ-type
SuperFamily	SSF57850	2.59E-13	39	102	No hit	No description
CDD	cd02335	4.63E-21	39	87	No hit	No description
PROSITE pattern	PS01357	0	41	68	IPR000433	Zinc finger, ZZ-type
SuperFamily	SSF46689	1.64E-10	93	145	IPR009057	Homeodomain-like
PROSITE profile	PS51293	21.36	94	146	IPR017884	SANT domain
SMART	SM00717	2.7E-9	95	144	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-9	98	140	IPR001005	SANT/Myb domain
CDD	cd00167	1.16E-11	99	141	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.2E-5	99	141	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MRSRGNFHNV EDSTQRICVT VENFESSSMV QGTEGGAKYN CNYCQKDITG KIRIKCAVCL 60 NFDLCVECMS AGAEINTHKC DHAYRVMGNL TFPLICPDWS ADDEMLLLEG LEMYGMGNMT 120 EVAEYVGSKS KEQCLEHYRN IYLNSPCFPL PV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6cw3_E	2e-35	35	151	1	117	Transcriptional adapter 2
6cw3_G	2e-35	35	151	1	117	Transcriptional adapter 2
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems, flowers and siliques, with the strongest activity in the meristematic zones. {ECO:0000269\|PubMed:11266554, ECO:0000269\|PubMed:12747832}.

Functional Description ? help Back to Top
Source	Description
UniProt	Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region. Mediates auxin and cytokinin signals in the control of cell proliferation and might be involved in repression of a freezing tolerance pathway at warm temperature (PubMed:12615937, PubMed:12747832). Involved in the positive regulation of salt-induced gene expression by maintaining locus-specific acetylation of histones H4 and H3 (PubMed:21193996). {ECO:0000250, ECO:0000269\|PubMed:12615937, ECO:0000269\|PubMed:12747832, ECO:0000269\|PubMed:21193996}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00056572001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353234	1e-129	AK353234.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-22-N10.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013691303.1	1e-111	uncharacterized protein LOC106395373
Swissprot	Q9ATB4	6e-89	TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBL	A0A078H7F8	1e-111	A0A078H7F8_BRANA; BnaC01g21680D protein
TrEMBL	A0A3N6RXK8	1e-109	A0A3N6RXK8_BRACR; Uncharacterized protein
STRING	Bo1g054810.1	1e-102	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM21599	2	2

Publications ? help Back to Top
Vlachonasios KE,Thomashow MF,Triezenberg SJ Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression. Plant Cell, 2003. 15(3): p. 626-38 [PMID:12615937] Sieberer T,Hauser MT,Seifert GJ,Luschnig C PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation. Curr. Biol., 2003. 13(10): p. 837-42 [PMID:12747832] Kerschen A,Napoli CA,Jorgensen RA,Müller AE Effectiveness of RNA interference in transgenic plants. FEBS Lett., 2004. 566(1-3): p. 223-8 [PMID:15147899] Hark AT, et al. Two Arabidopsis orthologs of the transcriptional coactivator ADA2 have distinct biological functions. Biochim. Biophys. Acta, 2009. 1789(2): p. 117-24 [PMID:18929690] Anzola JM, et al. Putative Arabidopsis transcriptional adaptor protein (PROPORZ1) is required to modulate histone acetylation in response to auxin. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10308-13 [PMID:20479223] Kaldis A,Tsementzi D,Tanriverdi O,Vlachonasios KE Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses. Planta, 2011. 233(4): p. 749-62 [PMID:21193996] Vlachonasios KE,Kaldis A,Nikoloudi A,Tsementzi D The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses. Plant Signal Behav, 2011. 6(10): p. 1475-8 [PMID:21897124] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Kazama D,Kurusu T,Mitsuda N,Ohme-Takagi M,Tada Y Involvement of elevated proline accumulation in enhanced osmotic stress tolerance in Arabidopsis conferred by chimeric repressor gene silencing technology. Plant Signal Behav, 2014. 9(3): p. e28211 [PMID:24614501] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Kim JY,Oh JE,Noh YS,Noh B Epigenetic control of juvenile-to-adult phase transition by the Arabidopsis SAGA-like complex. Plant J., 2015. 83(3): p. 537-45 [PMID:26095998] Kazama D, et al. Identification of Chimeric Repressors that Confer Salt and Osmotic Stress Tolerance in Arabidopsis. Plants (Basel), 2013. 2(4): p. 769-85 [PMID:27137403] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961] Lai J, et al. The Transcriptional Coactivator ADA2b Recruits a Structural Maintenance Protein to Double-Strand Breaks during DNA Repair in Plants. Plant Physiol., 2018. 176(4): p. 2613-2622 [PMID:29463775] Kotak J, et al. The histone acetyltransferase GCN5 and the transcriptional coactivator ADA2b affect leaf development and trichome morphogenesis in Arabidopsis. Planta, 2018. 248(3): p. 613-628 [PMID:29846775]