PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00057858001

Common Name

GSBRNA2T00057858001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

bZIP

Protein Properties

Length: 177aa MW: 19886.4 Da PI: 10.5535

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00057858001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	23.2	1.5e-07	35	75	14	54
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 R +A rs +RK +i+eLe++v++L++e ++L +l + GSBRNA2T00057858001 35 RQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 75 89******************************998877665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.1E-8	26	86	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.66E-7	33	77	No hit	No description
PROSITE profile	PS50217	9.059	33	87	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.7E-6	33	72	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MTPVKLLKET LKEVRNDWLS DGSVPLKRHG VRRRRQSAAR SKERKARYIQ ELERRVQSLQ 60 TEATTLSAQL TLFQRDTNGL ANENTELKMR LQAMEQQAHL RNALNEALRK KVERMKMETG 120 EISGKSDSFD MGMQQSVSEF LQNGRLQGLE ISSNNSSSLV KSEGPSLSGS ESSSAY*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed at high levels in roots, low level in leaf sheath, but not in leaf blade. Predominantly expressed in vascular tissues. {ECO:0000269\|PubMed:14704272}.
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269\|PubMed:27896439}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:14704272}.
UniProt	Transcrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269\|PubMed:27896439}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00057858001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009110972.1	1e-78	PREDICTED: transcription factor RF2b-like
Refseq	XP_013589290.1	1e-79	PREDICTED: transcription factor RF2b-like, partial
Refseq	XP_013657521.1	2e-78	transcription factor RF2b
Swissprot	O22873	1e-43	BZP18_ARATH; bZIP transcription factor 18
Swissprot	Q6S4P4	6e-44	RF2B_ORYSJ; Transcription factor RF2b
TrEMBL	A0A078H9D5	1e-123	A0A078H9D5_BRANA; BnaC06g13660D protein
STRING	Bra030663.1-P	5e-78	(Brassica rapa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G06850.1	3e-67	basic leucine-zipper 52

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Pawar V, et al. A novel family of plant nuclear envelope-associated proteins. J. Exp. Bot., 2016. 67(19): p. 5699-5710 [PMID:27630107] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S Efficient gene tagging in Arabidopsis thaliana using a gene trap approach. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7 [PMID:9356517]