![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00057970001 | ||||||||
| Common Name | GSBRNA2T00057970001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 139aa MW: 16090.8 Da PI: 10.6148 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 27.6 | 6.6e-09 | 40 | 83 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
rg+++ eE+e + ++++ W++Ia++++ gRt k +k+ w+
GSBRNA2T00057970001 40 RGNFSVEEEETITELHQSIEASMWSKIASKLP-GRTYKVIKNAWN 83
89******************************.********9998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.4E-8 | 23 | 45 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 4.25E-14 | 24 | 89 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 11.566 | 35 | 90 | IPR017930 | Myb domain |
| SMART | SM00717 | 0.0037 | 39 | 88 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.1E-7 | 40 | 84 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.26E-4 | 42 | 84 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-14 | 46 | 86 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MGKEERHVVT KPKSLPLNKL VIDKSCRLQW INYLRPDVKR GNFSVEEEET ITELHQSIEA 60 SMWSKIASKL PGRTYKVIKN AWNTGLTIHV QVKQTQGRLY FFTSLKSNEL QSKFSNNNYK 120 KIISLIKIMK KTSIYFIA* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00057970001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU579455 | 2e-54 | EU579455.1 Brassica oleracea clone BAC B77C13, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013585304.1 | 2e-26 | PREDICTED: myb-related protein Zm1-like | ||||
| Refseq | XP_018515313.1 | 2e-26 | PREDICTED: myb-related protein Myb4-like | ||||
| Swissprot | Q9SA47 | 3e-26 | MYB58_ARATH; Transcription factor MYB58 | ||||
| TrEMBL | A0A078HBG2 | 1e-96 | A0A078HBG2_BRANA; BnaA06g11070D protein | ||||
| TrEMBL | A0A3P5YQH0 | 1e-96 | A0A3P5YQH0_BRACM; Uncharacterized protein | ||||
| STRING | Bra026048.1-P | 8e-26 | (Brassica rapa) | ||||
| STRING | Bo5g021910.1 | 7e-26 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G16490.1 | 1e-28 | myb domain protein 58 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




