![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00060000001 | ||||||||
| Common Name | GSBRNA2T00060000001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 89aa MW: 9990.89 Da PI: 10.829 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 72.7 | 3.1e-23 | 19 | 62 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
ri+ ++ rqvtfskRr+g++KKA+EL++LC+aev +i++s+ k
GSBRNA2T00060000001 19 RIKKETHRQVTFSKRRAGLFKKASELCTLCGAEVGIIVYSPAKK 62
799*************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 4.71E-29 | 10 | 81 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.997 | 10 | 70 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.0E-31 | 10 | 69 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.83E-34 | 11 | 81 | No hit | No description |
| PRINTS | PR00404 | 5.9E-18 | 12 | 32 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.7E-26 | 19 | 66 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-18 | 32 | 47 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-18 | 47 | 68 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MMMSKKKETM GRQRIPMVRI KKETHRQVTF SKRRAGLFKK ASELCTLCGA EVGIIVYSPA 60 KKPFSFGHPS VESVLDRYLE TLQRAAAC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 5e-17 | 10 | 80 | 1 | 71 | MEF2C |
| 5f28_B | 5e-17 | 10 | 80 | 1 | 71 | MEF2C |
| 5f28_C | 5e-17 | 10 | 80 | 1 | 71 | MEF2C |
| 5f28_D | 5e-17 | 10 | 80 | 1 | 71 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00060000001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013689999.2 | 1e-53 | agamous-like MADS-box protein AGL61 | ||||
| Swissprot | Q4PSU4 | 1e-43 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
| TrEMBL | A0A078HEE9 | 3e-58 | A0A078HEE9_BRANA; BnaC04g37430D protein | ||||
| STRING | Bra032057.1-P | 8e-51 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24840.1 | 6e-46 | AGAMOUS-like 61 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




