| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 43.9 | 5.6e-14 | 11 | 46 | 12 | 48 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
l ++v+++G+++Wk+Ia+++g +R +kqc++rw+++l
GSBRNA2T00060389001 11 LRKLVELYGTKNWKRIANMLG-TRIGKQCRERWHNHL 46
899******************.*************97 PP
|
| 2 | Myb_DNA-binding | 56.5 | 6.5e-18 | 52 | 94 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ +WT+eEd++lv+a+k +G++ W++Ia ++ gRt++ +k+rw+
GSBRNA2T00060389001 52 KSAWTEEEDQILVEAHKVFGNK-WAKIALRLC-GRTENAIKNRWN 94
679*******************.*********.***********8 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Expressed in embryos from the early heart stage and throughout embryogenesis (PubMed:18695688, PubMed:19066902). Induced at the onset of the maturation phase in the endosperm, in a high and homogeneous repartition (PubMed:18695688, PubMed:19066902, PubMed:25194028, PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
| Uniprot | DEVELOPMENTAL STAGE: Induced at the onset of the maturation phase in the endosperm at low levels in a heterogeneous repartition, particularly in the chalazal endosperm. Also detected in pollen grains. {ECO:0000269|PubMed:27681170}. |
| Uniprot | TISSUE SPECIFICITY: Accumulates in reproductive organs (e.g. flowers and siliques) (PubMed:18695688, PubMed:27681170). Expressed at very low levels in vegetative organs (PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:27681170}. |
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in siliques (PubMed:18695688, PubMed:19066902). Also detected at low levels in leaves and flowers (PubMed:19066902). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
| UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of target genes (PubMed:27681170). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner (PubMed:18695688). Together with MYB118, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:27681170}. |