![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00069436001 | ||||||||
| Common Name | GSBRNA2T00069436001, LOC106364450 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 95aa MW: 10766.9 Da PI: 8.5092 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 24.7 | 4.2e-08 | 20 | 60 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+i + +L+ l+P++ + +s K+s + +L+++++YI++L
GSBRNA2T00069436001 20 DQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNL 60
68999999********889********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 2.2E-8 | 4 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 10.29 | 6 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 1.2E-5 | 20 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 8.24E-9 | 20 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MSSRRSSRSR QSGSSRISDD QISDLVTKLQ HLIPELRRRR SDKVSASKVL QETCNYIRNL 60 HREVDDLSDR LSEFLASTDD NSAEAAIIRS LLDY* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.3465 | 1e-115 | seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00069436001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK119110 | 1e-120 | AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20. | |||
| GenBank | BT004686 | 1e-120 | BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009103115.1 | 2e-59 | PREDICTED: transcription factor PRE6-like | ||||
| Refseq | XP_013659479.1 | 2e-59 | transcription factor PRE6 | ||||
| Swissprot | Q8GW32 | 4e-46 | PRE6_ARATH; Transcription factor PRE6 | ||||
| TrEMBL | A0A078HSJ4 | 5e-58 | A0A078HSJ4_BRANA; BnaA07g09310D protein | ||||
| TrEMBL | A0A397YNP0 | 5e-58 | A0A397YNP0_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4D7H5 | 5e-58 | M4D7H5_BRARP; Uncharacterized protein | ||||
| STRING | Bra012435.1-P | 8e-59 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM259 | 28 | 225 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 2e-44 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106364450 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




