![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00071285001 | ||||||||
| Common Name | GSBRNA2T00062878001, GSBRNA2T00071285001, LOC106345461, LOC106352827 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 77aa MW: 8144.84 Da PI: 10.7332 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 138.3 | 1.6e-43 | 8 | 76 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++a++eakGlnPGlivllvvgg+l+vflv+ny++yvyaqknlPPrkkkPvskkklkreklkqGv+vPGe
GSBRNA2T00071285001 8 GKAAAEAKGLNPGLIVLLVVGGPLVVFLVANYVMYVYAQKNLPPRKKKPVSKKKLKREKLKQGVPVPGE 76
57899***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 2.4E-38 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MDGEGFAGKA AAEAKGLNPG LIVLLVVGGP LVVFLVANYV MYVYAQKNLP PRKKKPVSKK 60 KLKREKLKQG VPVPGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.4135 | 1e-122 | seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00071285001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189269 | 3e-80 | AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009103859.1 | 1e-45 | PREDICTED: DNA-binding protein S1FA1 | ||||
| Refseq | XP_013590178.1 | 1e-45 | PREDICTED: DNA-binding protein S1FA1 | ||||
| Refseq | XP_013640119.1 | 1e-45 | DNA-binding protein S1FA1 | ||||
| Refseq | XP_013647922.1 | 1e-45 | DNA-binding protein S1FA1 | ||||
| Swissprot | Q42337 | 1e-23 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A078JPS2 | 3e-44 | A0A078JPS2_BRANA; BnaAnng24190D protein | ||||
| TrEMBL | A0A0D3CTK9 | 3e-44 | A0A0D3CTK9_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A397YNB9 | 3e-44 | A0A397YNB9_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6GQR7 | 3e-44 | A0A3P6GQR7_BRAOL; Uncharacterized protein | ||||
| STRING | Bo6g067310.1 | 5e-45 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106345461 | 106352827 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




