![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00071718001 | ||||||||
| Common Name | GSBRNA2T00071718001, LOC106380103 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 243aa MW: 28615.5 Da PI: 7.3955 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 80 | 1.6e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
k+ien + rqvtfskRr g++KKA+ELSvLCda + +i+fs tgkly +
GSBRNA2T00071718001 9 KKIENRTARQVTFSKRRSGVIKKAHELSVLCDAHIGLIVFSATGKLYQHC 58
68*********************************************987 PP
| |||||||
| 2 | K-box | 62.2 | 2.1e-21 | 83 | 167 | 11 | 95 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95
+ + e+ ++e++ L++e+ +L+ qR + G dL s+ eL +LeqqLe+s+ kiR++Knel+ +q+e+l +k ++l+e+n+++
GSBRNA2T00071718001 83 NDNREEFCHEIEVLRRETCKLELRQRIYRGHDLASIPPHELDELEQQLEHSVLKIRQRKNELMQQQLENLSRKRRMLEEDNNNMY 167
5678999**************************************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.2E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.515 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.74E-42 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 1.44E-30 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.6E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 3.2E-20 | 83 | 170 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 13.494 | 86 | 176 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 243 aa Download sequence Send to blast |
MGRGKIEIKK IENRTARQVT FSKRRSGVIK KAHELSVLCD AHIGLIVFSA TGKLYQHCTE 60 PLTMPQLIDR YLQTNGLRLP DPNDNREEFC HEIEVLRRET CKLELRQRIY RGHDLASIPP 120 HELDELEQQL EHSVLKIRQR KNELMQQQLE NLSRKRRMLE EDNNNMYRWL HGHRATTEFQ 180 QAGIETKPGE YQQFLEQVQF YNDHQQQPNS FLQLATLPSE IDLNYHLHLA QPNFQNDPMA 240 NI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-17 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_B | 2e-17 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_C | 2e-17 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_D | 2e-17 | 1 | 75 | 1 | 73 | MEF2C |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 152 | 157 | SRKRRM |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.13731 | 0.0 | seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00071718001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HM449990 | 0.0 | HM449990.1 Brassica napus cultivar DH12075 MADS-box DNA-binding domain transcription factor (TT16.3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013618046.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
| Refseq | XP_013618047.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X2 | ||||
| Refseq | XP_013618048.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X2 | ||||
| Refseq | XP_013618049.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X2 | ||||
| Refseq | XP_013675373.2 | 0.0 | protein TRANSPARENT TESTA 16 isoform X2 | ||||
| Refseq | XP_013675375.1 | 0.0 | protein TRANSPARENT TESTA 16 isoform X3 | ||||
| Refseq | XP_022551330.1 | 0.0 | protein TRANSPARENT TESTA 16 isoform X1 | ||||
| Refseq | XP_022551332.1 | 0.0 | protein TRANSPARENT TESTA 16 isoform X3 | ||||
| Swissprot | Q8RYD9 | 1e-131 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
| TrEMBL | A0A3P6DUZ1 | 1e-180 | A0A3P6DUZ1_BRAOL; Uncharacterized protein | ||||
| STRING | Bo2g160980.1 | 0.0 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6506 | 25 | 43 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G23260.2 | 1e-127 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106380103 |




