PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00072378001

Common Name

GSBRNA2T00072378001, LOC106432035, LOC106432036

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NF-YB

Protein Properties

Length: 185aa MW: 19883.8 Da PI: 6.3563

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00072378001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.8	3.3e-58	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++r GSBRNA2T00072378001 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFR 115 89************************************************************************************** PP NF-YB 92 elegek 97 e+ege+ GSBRNA2T00072378001 116 EIEGER 121 **97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.1E-54	20	133	IPR009072	Histone-fold
SuperFamily	SSF47113	7.45E-42	28	154	IPR009072	Histone-fold
Pfam	PF00808	1.1E-28	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.8E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	6.8E-21	78	96	No hit	No description
PRINTS	PR00615	6.8E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MGDSDRDSGG GQTGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ 60 ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE 120 RTGLGRPQTG GEAGEHQRDG DGGGGYYGGG MGMGYQQHHQ FLQQQNHMYG STGGGGGGHS 180 GGRS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-49	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	9e-49	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.4395	0.0	leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:9662544}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00072378001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC155343	0.0	AC155343.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH077A05, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013728331.1	1e-134	nuclear transcription factor Y subunit B-2-like
Refseq	XP_013728333.1	1e-134	nuclear transcription factor Y subunit B-2-like
Refseq	XP_018510295.1	1e-134	PREDICTED: nuclear transcription factor Y subunit B-2
Swissprot	Q9FGJ3	2e-87	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A078HTQ1	1e-132	A0A078HTQ1_BRANA; BnaA09g18400D protein
TrEMBL	A0A397XV65	1e-132	A0A397XV65_BRACM; Uncharacterized protein
TrEMBL	M4DLU2	1e-132	M4DLU2_BRARP; Uncharacterized protein
STRING	Bra017473.1-P	1e-133	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	2e-86	nuclear factor Y, subunit B2

Link Out ? help Back to Top
Entrez Gene	106432035 \| 106432036

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]