![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00077584001 | ||||||||
| Common Name | GSBRNA2T00077584001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 102aa MW: 11227.3 Da PI: 10.8287 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.7 | 3.2e-18 | 33 | 66 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
Cs C+ttkTp+WR gp+g+k+LCnaCG++ k++
GSBRNA2T00077584001 33 CSECKTTKTPMWRGGPSGPKSLCNACGIRLMKQR 66
****************************988876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 6.65E-14 | 26 | 67 | No hit | No description |
| SMART | SM00401 | 5.3E-16 | 27 | 83 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.991 | 27 | 60 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.8E-15 | 31 | 67 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.21E-9 | 33 | 67 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 33 | 58 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 5.9E-16 | 33 | 66 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MLYKNIQRFL ATVVSKGALI TKMEEEKKTV RCCSECKTTK TPMWRGGPSG PKSLCNACGI 60 RLMKQRRSEL LGIRIIHSHK AYKKINSSPS SLSFSHGGVS L* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00077584001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493761 | 2e-44 | AB493761.1 Arabidopsis thaliana At5g26930 mRNA for hypothetical protein, partial cds, clone: RAAt5g26930. | |||
| GenBank | AY086778 | 2e-44 | AY086778.1 Arabidopsis thaliana clone 27625 mRNA, complete sequence. | |||
| GenBank | BT024789 | 2e-44 | BT024789.1 Arabidopsis thaliana At5g26930 gene, complete cds. | |||
| GenBank | DQ446989 | 2e-44 | DQ446989.1 Arabidopsis thaliana clone pENTR221-At5g26930 zinc finger family protein (At5g26930) mRNA, complete cds. | |||
| GenBank | DQ653310 | 2e-44 | DQ653310.1 Arabidopsis thaliana clone 0000012664_0000009184 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013597259.1 | 2e-46 | PREDICTED: GATA transcription factor 23-like | ||||
| Swissprot | Q8LC59 | 4e-35 | GAT23_ARATH; GATA transcription factor 23 | ||||
| TrEMBL | A0A078JT08 | 1e-67 | A0A078JT08_BRANA; BnaAnng28230D protein | ||||
| STRING | Bra009926.1-P | 2e-51 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM14484 | 16 | 22 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 1e-34 | GATA transcription factor 23 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




