![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00082681001 | ||||||||
| Common Name | GSBRNA2T00082681001, LOC106444269, TT16.2, TT16a | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 243aa MW: 28568.2 Da PI: 6.9148 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 81.2 | 6.9e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRr g++KK +ELSvLCda + +i+fs tgkl ey+s
GSBRNA2T00082681001 9 KRIENRTSRQVTFSKRRSGLIKKTHELSVLCDAHIGLIVFSATGKLTEYCS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 61.7 | 2.8e-21 | 85 | 168 | 13 | 96 |
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96
+e+l+qe++ L++e+ +L+ +R + G dL s+ eL LeqqLe+s+ k+R++Knell +q+e+l +k ++l+++nk++ +
GSBRNA2T00082681001 85 GQEELYQEIEVLRRETCKLELRLRPYHGHDLASIPPHELDALEQQLEHSVLKVRERKNELLQQQLENLSRKRRMLEDDNKNMYR 168
5789***************************************************************************99866 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 30.782 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.4E-31 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.16E-43 | 2 | 79 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.9E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.0E-20 | 84 | 170 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 14.101 | 86 | 176 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0008360 | Biological Process | regulation of cell shape | ||||
| GO:0019252 | Biological Process | starch biosynthetic process | ||||
| GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
| GO:0048316 | Biological Process | seed development | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
| GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 243 aa Download sequence Send to blast |
MGRGKIEIKR IENRTSRQVT FSKRRSGLIK KTHELSVLCD AHIGLIVFSA TGKLTEYCSD 60 PSKMPQLIER YLQTNGLRLP DPNDGQEELY QEIEVLRRET CKLELRLRPY HGHDLASIPP 120 HELDALEQQL EHSVLKVRER KNELLQQQLE NLSRKRRMLE DDNKNMYRWL HEHRTAMEFQ 180 QAGIETKPGE YQQFLEQVQY YNDHHQQQQQ QPNSVLQLAT LPSEIDPNYH LQLAQPNLQN 240 DN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-18 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_B | 3e-18 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_C | 3e-18 | 1 | 75 | 1 | 73 | MEF2C |
| 5f28_D | 3e-18 | 1 | 75 | 1 | 73 | MEF2C |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 152 | 157 | SRKRRM |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.28263 | 0.0 | seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00082681001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU192029 | 0.0 | EU192029.1 Brassica napus MADS-box DNA-binding domain transcription factor (TT16.2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013596700.1 | 1e-179 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X1 | ||||
| Swissprot | Q8RYD9 | 1e-141 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
| TrEMBL | A0A3P6E5I9 | 1e-178 | A0A3P6E5I9_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g097810.1 | 1e-179 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6506 | 25 | 43 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G23260.2 | 1e-125 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106444269 |




