PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00083899001

Common Name

GSBRNA2T00083899001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 189aa MW: 21724.3 Da PI: 6.9347

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00083899001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59	1.1e-18	13	58	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE+ l +++++++G++ W++Iar+++ gRt++++k++w++++ GSBRNA2T00083899001 13 RGKMTPEEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 58 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.9E-4	1	19	IPR009057	Homeodomain-like
SuperFamily	SSF46689	7.85E-19	2	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	27.675	8	62	IPR017930	Myb domain
SMART	SM00717	6.5E-18	12	60	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-17	13	57	IPR001005	SANT/Myb domain
CDD	cd00167	2.74E-13	15	58	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-21	20	59	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 189 aa Download sequence Send to blast
LRWVNYLHPG LKRGKMTPEE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK 60 IAQEKKRPMS PTSSSSNFCS SSMTTATTQD TGRSEGKMNQ ECEDGYYSMD DIWREIDQSG 120 ESITKPVKGM YYSEQSCYLN FPPLASPAWE SSLESIWNMD ADESKMSSFA IDQFPLSFEH 180 GSSWSSLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-14	2	60	45	103	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-14	2	60	99	157	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-14	2	60	99	157	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	3e-14	2	60	68	126	MYB TRANSFORMING PROTEIN
1mse_C	1e-14	2	60	45	103	C-Myb DNA-Binding Domain
1msf_C	1e-14	2	60	45	103	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00083899001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229048	0.0	AK229048.1 Arabidopsis thaliana mRNA for MYB27 protein - like, complete cds, clone: RAFL16-34-F17.
GenBank	AY519641	0.0	AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
GenBank	DQ075252	0.0	DQ075252.1 Arabidopsis thaliana MYB transcription factor MYB59-1 (At5g59780) mRNA, complete cds, alternatively spliced.
GenBank	DQ075253	0.0	DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013618692.1	1e-137	PREDICTED: transcription factor MYB59 isoform X1
Refseq	XP_013618693.1	1e-137	PREDICTED: transcription factor MYB59 isoform X2
Swissprot	Q4JL84	1e-113	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A078JQV8	1e-138	A0A078JQV8_BRANA; BnaCnng62330D protein (Fragment)
STRING	Bo2g025410.1	1e-136	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2502	27	74

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.2	1e-112	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]