![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00089502001 | ||||||||
| Common Name | GSBRNA2T00089502001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 154aa MW: 17624.4 Da PI: 10.3748 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.1 | 1.1e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev viifsstgkly+++s
GSBRNA2T00089502001 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDFAS 59
8***********************************************86 PP
| |||||||
| 2 | K-box | 63.5 | 7.8e-22 | 82 | 143 | 9 | 70 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70
+++++ + +q+e+a L+++++ Lq+ +R+l+Ge+L+ ++ ++Lq+Le+qLekslk +R kK
GSBRNA2T00089502001 82 NHASEIKFWQREVATLQQQLHYLQQCHRKLIGEELSGMNANDLQNLEDQLEKSLKGVRLKKV 143
688999*****************************************************995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.791 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.67E-40 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 2.62E-32 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.1E-17 | 83 | 142 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 9.684 | 87 | 153 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007584 | Biological Process | response to nutrient | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0071249 | Biological Process | cellular response to nitrate | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008134 | Molecular Function | transcription factor binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 154 aa Download sequence Send to blast |
MGRGKIIIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVIIFSS TGKLYDFASN 60 SSMKSIIGRY NKVKEEQHQL LNHASEIKFW QREVATLQQQ LHYLQQCHRK LIGEELSGMN 120 ANDLQNLEDQ LEKSLKGVRL KKVICINLSK SYW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-19 | 1 | 82 | 1 | 81 | MEF2C |
| 5f28_B | 1e-19 | 1 | 82 | 1 | 81 | MEF2C |
| 5f28_C | 1e-19 | 1 | 82 | 1 | 81 | MEF2C |
| 5f28_D | 1e-19 | 1 | 82 | 1 | 81 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00089502001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228244 | 1e-152 | AK228244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-69-G23. | |||
| GenBank | BT005861 | 1e-152 | BT005861.1 Arabidopsis thaliana At2g14210 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009123192.1 | 6e-99 | PREDICTED: MADS-box transcription factor ANR1 | ||||
| Swissprot | Q9SI38 | 1e-85 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
| TrEMBL | A0A078IEI8 | 1e-107 | A0A078IEI8_BRANA; BnaAnng09810D protein | ||||
| STRING | XP_010527021.1 | 8e-86 | (Tarenaya hassleriana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM530 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 1e-87 | AGAMOUS-like 44 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




