![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00091509001 | ||||||||
| Common Name | GSBRNA2T00091509001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 182aa MW: 19910.5 Da PI: 8.2137 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 143.2 | 7.8e-45 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
GSBRNA2T00091509001 12 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRL 101
7***************************************************************************************** PP
DUF260 91 kaelallke 99
++el+++++
GSBRNA2T00091509001 102 QKELDAANA 110
****99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 28.183 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.6E-44 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 182 aa Download sequence Send to blast |
MASSSSNTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPHK FANVHKIFGA SNVTKLLNEL 60 LPHQREDAVN SLAYEAEARV RDPVYGCVGA ISYLQRQVHR LQKELDAANA DLVHYGMSTS 120 TPGNVVDLVF QPQPFPPQPL NPVYRLSGSS PVMTQQPRGT GGSYGTFLPW NNGHDQQGGN 180 M* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-65 | 2 | 122 | 1 | 127 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-65 | 2 | 122 | 1 | 127 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00091509001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB008265 | 1e-171 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
| GenBank | AB164305 | 1e-171 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
| GenBank | AB473837 | 1e-171 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
| GenBank | AF447897 | 1e-171 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
| GenBank | BT025745 | 1e-171 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
| GenBank | CP002688 | 1e-171 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009150368.1 | 1e-135 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_009150369.1 | 1e-135 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Swissprot | Q9FML4 | 1e-123 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A078JVX7 | 1e-133 | A0A078JVX7_BRANA; BnaAnng31240D protein | ||||
| TrEMBL | A0A291LQX1 | 1e-133 | A0A291LQX1_BRARR; Transcription factor LOB | ||||
| TrEMBL | A0A397Z486 | 1e-133 | A0A397Z486_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4FBZ0 | 1e-133 | M4FBZ0_BRARP; Uncharacterized protein | ||||
| STRING | Bra038606.1-P | 1e-134 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-118 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




