PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00092496001

Common Name

GSBRNA2T00092496001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 289aa MW: 32381.5 Da PI: 4.5313

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00092496001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.1	5.5e-15	6	51	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ eE+++++ +++ G++ W+ Iar+++ +Rt++++k++w+++l GSBRNA2T00092496001 6 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 51 899*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.0E-22	1	55	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.741	1	55	IPR017930	Myb domain
SuperFamily	SSF46689	2.92E-14	2	61	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-13	5	53	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-13	6	51	IPR001005	SANT/Myb domain
CDD	cd00167	1.42E-10	8	51	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 289 aa Download sequence Send to blast
KPDIKRGEFS YEEEQIIIML HASRGNKWSV IARHLPKRTD NEVKNYWNTH LKKRLIDQGI 60 DPLTHKPLAS NPNPATPRTS EGQDDSNPIN LDEQSQSGSM SPKSLPHSSS SCNLQTIINS 120 DETPRNNGSL SSKKCRFKKL SSTSKLLNKV ATKASSIGNM LSASMEGSLI RSTTLSPCLN 180 DMDEFDPFSH SSEQHITDHM KEDINMDFDL NNSEFDFSQF IEQFSNIEAE EANAIGGYNQ 240 DLLLSDVSST SVDEDNVMQN ITGWSNYLVD DSDFPYDTNQ DFDDKNFI*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Primarily present around the midvein in seedlings. Accumulates gradually in expanding leaves, reaching a maximum in fully expanded leaves in the primary vein. {ECO:0000269\|PubMed:18042203}.
Uniprot	TISSUE SPECIFICITY: Expressed in both vegetative and generative organs. Mostly present in seedlings, inflorescences, roots and stems, and, to a lower extent, in leaves (in midvein and trichomes) and siliques. {ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23115560, ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a minor rheostat role in aliphatic glucosinolates (GLSs) biosynthesis, mostly short chained. Together with MYB28/HAG1 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae) by promoting glucosinolates. {ECO:0000269\|PubMed:17420480, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:18446225, ECO:0000269\|PubMed:20348214, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:23943862}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00092496001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by gibberellic acid (GA), jasmonic acid (JA, MeJA), nitrogen starvation and UV LIGHT treatment. Transiently repressed by salicylic acid (SA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ584292	1e-157	FJ584292.1 Brassica rapa subsp. pekinensis MYB domain protein 29-3 gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013609260.1	0.0	PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB29
Swissprot	Q9FLR1	1e-129	MYB29_ARATH; Transcription factor MYB29
TrEMBL	A0A078JSL9	0.0	A0A078JSL9_BRANA; BnaCnng65380D protein (Fragment)
STRING	Bo9g175680.1	0.0	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3787	18	60

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07690.1	1e-110	myb domain protein 29

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Araki R, et al. Novel bioresources for studies of Brassica oleracea: identification of a kale MYB transcription factor responsible for glucosinolate production. Plant Biotechnol. J., 2013. 11(8): p. 1017-27 [PMID:23910994] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Burow M, et al. The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis. Mol Plant, 2015. 8(8): p. 1201-12 [PMID:25758208] Martínez-Ballesta M, et al. The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 524 [PMID:26236322] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Mostafa I, et al. New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants. J Proteomics, 2016. 138: p. 1-19 [PMID:26915584] Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding. Plant Physiol., 2016. 172(1): p. 181-97 [PMID:27482077] Zhang X, et al. The Transcription Factor MYB29 Is a Regulator of ALTERNATIVE OXIDASE1a. Plant Physiol., 2017. 173(3): p. 1824-1843 [PMID:28167700] Mostafa I, et al. Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29. Front Plant Sci, 2017. 8: p. 534 [PMID:28443122] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]