PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00094309001
Common NameGSBRNA2T00094309001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 66aa    MW: 6771.63 Da    PI: 4.7341
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00094309001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM24.38.6e-082355235
                  NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevik 35
                         +p f FhPtdee++++yLk++v +++++l   i 
  GSBRNA2T00094309001 23 APAFLFHPTDEEVLSYYLKRNVLSRTVRL-GGIG 55
                         6899*******************999877.4444 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-81558IPR003441NAC domain
PROSITE profilePS5100510.5222265IPR003441NAC domain
PfamPF023651.4E-42445IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MADESSPPSA TSPATSVAAT SLAPAFLFHP TDEEVLSYYL KRNVLSRTVR LGGIGVVDTS  60
MSLGT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00094309001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018439554.12e-20PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9SQX92e-19NAC50_ARATH; NAC domain containing protein 50
TrEMBLA0A078JR143e-38A0A078JR14_BRANA; BnaCnng66390D protein
TrEMBLA0A3P6F5513e-38A0A3P6F551_BRAOL; Uncharacterized protein
STRINGBo1g134910.12e-33(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-10NAC domain containing protein 50
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]