![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00094672001 | ||||||||
| Common Name | GSBRNA2T00094672001, LOC106366094 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 194aa MW: 22835.2 Da PI: 9.8544 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.3 | 5.4e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRrng+lKKA+ELSvLCda+v++i+fs++g+lye+ss
GSBRNA2T00094672001 9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQVSLIVFSQRGRLYEFSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 67 | 6.4e-23 | 77 | 170 | 4 | 97 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93
++++ +e ++l+qe++ + ++ie L+ +R+llG++L+s+sl+eLq++ +qL++sl ++R++K ++++eq+e+l+ kek+l een +
GSBRNA2T00094672001 77 ETSNQYSEMYIQQLKQEASHMIAKIELLEFHKRKLLGQELSSCSLQELQEIDSQLQRSLGEVRARKAQMFKEQLEKLKAKEKQLLEENVQ 166
44555788899******************999********************************************************** PP
K-box 94 Lrkk 97
L++k
GSBRNA2T00094672001 167 LHQK 170
**98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.352 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.5E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.11E-34 | 3 | 86 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.06E-42 | 3 | 78 | No hit | No description |
| Pfam | PF00319 | 5.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 13.089 | 87 | 186 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 2.0E-22 | 87 | 170 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 194 aa Download sequence Send to blast |
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQVSLIVFSQ RGRLYEFSSS 60 DMQNTIERYH TYRNDHETSN QYSEMYIQQL KQEASHMIAK IELLEFHKRK LLGQELSSCS 120 LQELQEIDSQ LQRSLGEVRA RKAQMFKEQL EKLKAKEKQL LEENVQLHQK NVIDPWRGSI 180 DQQKKFRVID LNL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 9e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00094672001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY054220 | 0.0 | AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
| GenBank | AY065206 | 0.0 | AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
| GenBank | AY066035 | 0.0 | AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
| GenBank | AY096509 | 0.0 | AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
| GenBank | AY141213 | 0.0 | AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009112008.1 | 1e-139 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_013661108.1 | 1e-139 | MADS-box protein AGL42 isoform X1 | ||||
| Swissprot | Q9FIS1 | 1e-116 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A078FVH4 | 1e-138 | A0A078FVH4_BRANA; BnaA09g05900D protein | ||||
| TrEMBL | A0A3P5Y8H8 | 1e-138 | A0A3P5Y8H8_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4F4A7 | 1e-137 | M4F4A7_BRARP; Uncharacterized protein | ||||
| STRING | Bra035907.1-P | 1e-138 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 1e-105 | AGAMOUS-like 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106366094 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




