PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00095501001

Common Name

GSBRNA2T00042093001, GSBRNA2T00056196001, GSBRNA2T00095501001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 98aa MW: 11519.2 Da PI: 9.5364

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00095501001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	64.4	2.2e-20	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd +l+ +++q+G+++W++I++ g+ R++k+c++rw +yl GSBRNA2T00095501001 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-26	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.472	9	65	IPR017930	Myb domain
SMART	SM00717	3.2E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.3E-19	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.49E-23	15	89	IPR009057	Homeodomain-like
CDD	cd00167	3.51E-12	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.4E-7	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY 60 LRPDLKHGQF SEAEEHIIVK FHSVLGNRYD FFSYMVY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-17	14	96	7	88	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During anther development, expressed from stage 4 to stage 6 in microsporocytes and tapetal cells. At the tetrad stage, expressed predominantly in tapetal cells. During microgametogenesis, expression decreases radically in the tapetum and microspores. {ECO:0000269\|PubMed:21957980}.
Uniprot	TISSUE SPECIFICITY: Expressed in the tapetum and middle layer of developing anthers (PubMed:10353220). Expressed in trichomes (PubMed:12848824). {ECO:0000269\|PubMed:10353220, ECO:0000269\|PubMed:12848824}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269\|PubMed:12848824, ECO:0000269\|PubMed:17727613, ECO:0000269\|PubMed:21673079}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00095501001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493793	1e-98	AB493793.1 Arabidopsis thaliana At5g56110 mRNA for hypothetical protein, partial cds, clone: RAAt5g56110.
GenBank	AY519639	1e-98	AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002864431.1	4e-63	cytochrome c oxidase assembly protein COX15
Swissprot	Q9XHV0	4e-62	MYB80_ARATH; Transcription factor MYB80
TrEMBL	A0A078FYG3	2e-68	A0A078FYG3_BRANA; BnaA02g28360D protein
STRING	Al_scaffold_0008_2049	2e-62	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56110.1	2e-64	myb domain protein 103

Publications ? help Back to Top
Li SF,Iacuone S,Parish RW Suppression and restoration of male fertility using a transcription factor. Plant Biotechnol. J., 2007. 5(2): p. 297-312 [PMID:17309685] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Qian H, et al. Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis. Ecotoxicology, 2015. 24(1): p. 163-71 [PMID:25348600] Xiong SX, et al. The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana. Plant J., 2016. 88(6): p. 936-946 [PMID:27460657] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]