![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00096923001 | ||||||||
| Common Name | GSBRNA2T00096923001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 158aa MW: 18103.3 Da PI: 10.3705 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134 | 4.9e-42 | 54 | 129 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqv++C++dl+e k+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
GSBRNA2T00096923001 54 CQVDRCTTDLKEDKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSS 129
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 3.4E-56 | 1 | 141 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 3.9E-32 | 48 | 115 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.872 | 51 | 128 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 2.88E-38 | 53 | 132 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 3.1E-32 | 54 | 127 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MEGKKAQGLG YLKKKASMSS YQEEEEVERE EEKRKGVMDR SKGSSSNRVS SRLCQVDRCT 60 TDLKEDKQYH RRHKVCEVHA KASSVYLAGV KQRFCQQCSR FHELPEFDEA KRSCRRRLAG 120 HNERRRKSSG ESFGEGSGGR RGVTGQVMQN QERSKIR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 8e-44 | 52 | 127 | 9 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the inflorescence apical meristem and young flowers. {ECO:0000269|PubMed:10524240}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00096923001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353439 | 2e-92 | AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013746617.2 | 6e-94 | squamosa promoter-binding-like protein 5 | ||||
| Refseq | XP_018514341.1 | 6e-94 | PREDICTED: squamosa promoter-binding-like protein 5 isoform X2 | ||||
| Swissprot | Q9S758 | 4e-71 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
| TrEMBL | A0A078IHT0 | 1e-108 | A0A078IHT0_BRANA; Squamosa promoter-binding-like protein | ||||
| STRING | Bra038101.1-P | 7e-91 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 1e-49 | squamosa promoter binding protein-like 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




