PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00100394001

Common Name

GSBRNA2T00100394001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

LBD

Protein Properties

Length: 93aa MW: 10635.5 Da PI: 9.9296

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00100394001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	51.5	2.9e-16	17	73	44	100
DUF260 44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 k+++++++++r++ ++sl++eAear+rdPvyG+vg+i+ lq++l++l+ l+ k+e GSBRNA2T00100394001 17 KIINEIDPSQRQACVDSLCFEAEARIRDPVYGCVGIIRGLQRRLQHLQLSLNISKRE 73 7899********************************************999988776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	10.496	1	74	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	5.9E-15	17	69	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MEPCAICKEK RQKCTKKIIN EIDPSQRQAC VDSLCFEAEA RIRDPVYGCV GIIRGLQRRL 60 QHLQLSLNIS KRELAMIKHG QIHQHLSVRS RL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	1e-15	3	82	11	119	LOB family transfactor Ramosa2.1
5ly0_B	1e-15	3	82	11	119	LOB family transfactor Ramosa2.1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00100394001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024634719.1	3e-20	LOB domain-containing protein 11
Swissprot	O64836	6e-17	LBD10_ARATH; LOB domain-containing protein 10
TrEMBL	A0A3P5YZP8	4e-57	A0A3P5YZP8_BRACM; Uncharacterized protein
STRING	Bo5g010610.1	1e-55	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G23660.2	2e-15	LOB domain-containing protein 10

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Kim MJ,Kim M,Kim J Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis. Plant Signal Behav, 2015. 10(8): p. e1044193 [PMID:26252070] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]