PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00101975001

Common Name

GSBRNA2T00101975001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

YABBY

Protein Properties

Length: 181aa MW: 19745.5 Da PI: 10.157

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00101975001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	142.2	5.8e-44	14	156	4	163
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesas 93 ++e++ yv+C+ Cntilav +P++ ++ +vtv+CGhC +l ++ + + + h + +l++ + ++ + k+ s+s GSBRNA2T00101975001 14 SPQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTTT-----PPLQGH----VSLTLQQMQ-----SFGGSEYKKGSSS 89 5689**********************************97553332.....233333....223333333.....3444444445544 PP YABBY 94 tsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 +s ss +++++ +pr+p v++PPek+qr Psaynrf+++eiqrik++nP+i hreafsaaaknWa + GSBRNA2T00101975001 90 SSSSS---TSSDQPPSPRPPFVVKPPEKKQRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKY 156 44444...3467788999999*********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.3E-50	17	156	IPR006780	YABBY protein
SuperFamily	SSF47095	1.26E-8	100	155	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	7.0E-5	110	155	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 181 aa Download sequence Send to blast
MNLEEKPTMA SRVSPQAEHL YYVRCSICNT ILAVGIPMKR MLDTVTVKCG HCGNLSFLTT 60 TPPLQGHVSL TLQQMQSFGG SEYKKGSSSS SSSSTSSDQP PSPRPPFVVK PPEKKQRLPS 120 AYNRFMRDEI QRIKSANPEI PHREAFSAAA KNWAKYIPNS PTSITSGASN IHGFGFGEKK 180 *

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In carpels, expression starts when the gynoecial primordia becomes distinct. First expressed in the lateral region of each carpel. Later resolves into two distinct domains, epidermal and internal. In epidermal tissues, mostly localized on the outer surface, successively from the base to the tip of the gynoecium and finally confined to the valve region before disappearing during last flowering stages. In internal tissues, first confined to four discrete zones adjacent to the future placental tissue occupying the full length of the elongating cylinder, declining from the apical regions and disappearing after the ovule primordia arise. Before nectaries initiation, expression occupies a ring of receptacle cells between the stamen and sepal primordia, from where nectaries will develop. Strongly expressed in nectaries until latest flowering stages. {ECO:0000269\|PubMed:10225998}.
Uniprot	TISSUE SPECIFICITY: Restricted to flowers, mostly in carpels and nectaries. Expressed at low levels in sepal primordia (buds), sepal receptacle and developing petal. Not detected in placental tissues, septum, stigma and ovules. {ECO:0000269\|PubMed:10225998}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00101975001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ119055	0.0	DQ119055.1 Brassica juncea transcription factor CRC mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009105464.1	1e-122	PREDICTED: protein CRABS CLAW
Refseq	XP_013652319.1	1e-122	protein CRABS CLAW
Swissprot	Q8L925	1e-107	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A3P6BLF5	1e-131	A0A3P6BLF5_BRACM; Uncharacterized protein
STRING	Bo6g108630.1	1e-118	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9725	28	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	1e-108	YABBY family protein

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]