PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00103807001
Common NameGSBRNA2T00103807001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CAMTA
Protein Properties Length: 80aa    MW: 9821.27 Da    PI: 8.2318
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00103807001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1132.71.3e-4117841118
                 CG-1  41 LynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                          +++rk++ryfrkDG++w+kkkdg tv+E+hekLKvg+++vl+cyYah e+n++fqrrcyw+Le+el ++v+v+ylevk
  GSBRNA2T00103807001   1 MFDRKVLRYFRKDGHNWRKKKDGETVKEAHEKLKVGSIDVLHCYYAHEEDNENFQRRCYWMLEQELMHVVFVQYLEVK 78 
                          79*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010765.6E-33178IPR005559CG-1 DNA-binding domain
PfamPF038591.5E-34177IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143756.606179IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MFDRKVLRYF RKDGHNWRKK KDGETVKEAH EKLKVGSIDV LHCYYAHEED NENFQRRCYW  60
MLEQELMHVV FVQYLEVKV*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, old leaves, petals, sepals, top of carpels, stigmas, stamen filaments, anthers and siliques, but not in pollen. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00103807001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4938113e-77AB493811.1 Arabidopsis thaliana At5g64220 mRNA for hypothetical protein, partial cds, clone: RAAt5g64220.
GenBankAK2294033e-77AK229403.1 Arabidopsis thaliana mRNA for Calmodulin-binding transcription activator 2, complete cds, clone: RAFL16-66-C08.
GenBankBT0108743e-77BT010874.1 Arabidopsis thaliana At5g64220 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279929.16e-48calmodulin-binding transcription activator 2 isoform X1
SwissprotQ6NPP48e-49CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A3N6UI725e-47A0A3N6UI72_BRACR; Uncharacterized protein
STRINGXP_006279929.12e-47(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1928046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.23e-51Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains
Publications ? help Back to Top
  1. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]