![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00104225001 | ||||||||
| Common Name | GSBRNA2T00104225001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 148aa MW: 17044.1 Da PI: 9.8689 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104 | 7.9e-33 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt+ gC+vkk+v+r ++d++vv++tYeg H h+
GSBRNA2T00104225001 68 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYGGCNVKKQVQRLTSDQEVVVTTYEGVHSHP 126
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 53 | 126 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.57E-29 | 60 | 127 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.136 | 63 | 128 | IPR003657 | WRKY domain |
| SMART | SM00774 | 5.8E-38 | 68 | 127 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.1E-26 | 69 | 126 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MEGYDDGSLY APFLSLKPHQ SLSKSELEQG REEASKVSEG SSRSRDLKKK KGKKQKFAFQ 60 TRSQVDILDD GYRWRKYGQK AVKNNKFPRS YYRCTYGGCN VKKQVQRLTS DQEVVVTTYE 120 GVHSHPIEKS TENFEHILTQ MQIYSSF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 7e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 7e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.29080 | 1e-119 | leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00104225001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM593162 | 0.0 | KM593162.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY106) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013609964.1 | 1e-106 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 4e-83 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A0A7RI98 | 1e-105 | A0A0A7RI98_BRAOC; WRKY106 protein | ||||
| TrEMBL | A0A3P6DQZ3 | 1e-105 | A0A3P6DQZ3_BRAOL; Uncharacterized protein | ||||
| STRING | Bo9g169080.1 | 1e-105 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 1e-83 | WRKY DNA-binding protein 75 | ||||




