![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00109570001 | ||||||||
| Common Name | GSBRNA2T00109570001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 97aa MW: 11148.9 Da PI: 8.488 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 101.7 | 1.1e-31 | 1 | 93 | 267 | 360 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
+f+s++++lpr++++ri+vE+++l+r++vn++acega+r+erhe l+kWr+r+ +aGF+p+pls +++++k+llr+++++ yr+ee++g
GSBRNA2T00109570001 1 MFESIDVTLPRNHKQRINVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFCMAGFTPYPLSPLVNSTIKTLLRNYSDK-YRLEERDG 89
7******************************************************************************55.******** PP
GRAS 357 slvl 360
+l++
GSBRNA2T00109570001 90 ALYI 93
9985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03514 | 3.6E-29 | 1 | 93 | IPR005202 | Transcription factor GRAS |
| PROSITE profile | PS50985 | 19.245 | 1 | 88 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MFESIDVTLP RNHKQRINVE QHCLARDVVN IIACEGADRV ERHELLGKWR SRFCMAGFTP 60 YPLSPLVNST IKTLLRNYSD KYRLEERDGA LYILVG* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00109570001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189305 | 1e-118 | AC189305.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB031O20, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013725214.1 | 5e-62 | scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_018440830.1 | 1e-58 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_018440831.1 | 1e-58 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_018440832.1 | 1e-58 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Swissprot | Q9LDL7 | 2e-59 | PAT1_ARATH; Scarecrow-like transcription factor PAT1 | ||||
| TrEMBL | A0A3P6E176 | 5e-66 | A0A3P6E176_BRAOL; Uncharacterized protein | ||||
| STRING | Bo9g009240.1 | 1e-64 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM31727 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48150.2 | 1e-61 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




