![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00110227001 | ||||||||
| Common Name | GSBRNA2T00110227001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 219aa MW: 25232.3 Da PI: 8.6958 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.5 | 8.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+lye+ss
GSBRNA2T00110227001 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQNGRLYEFSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 55.7 | 2.2e-19 | 88 | 156 | 14 | 82 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82
e+l++e++ + k+i+ L+ +qR+l+G++L+s+s+ eLq++ q+eksl+ +Rs+K el+ +q+ +l++
GSBRNA2T00110227001 88 LEELKKEMDIMVKKIDLLEVQQRKLMGQGLGSCSVAELQEIDIQIEKSLRIVRSRKAELYADQLGKLKE 156
68899***********************************************************99986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.525 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.08E-41 | 3 | 72 | No hit | No description |
| PRINTS | PR00404 | 4.1E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.84E-32 | 3 | 79 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.1E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.1E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.352 | 88 | 194 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 3.7E-18 | 89 | 156 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009909 | Biological Process | regulation of flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 219 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ NGRLYEFSSS 60 EMEKTIERYG DFRNEYFVLG RPQVQPYLEE LKKEMDIMVK KIDLLEVQQR KLMGQGLGSC 120 SVAELQEIDI QIEKSLRIVR SRKAELYADQ LGKLKEMCFS HTCYEKILCF QEIRERLLRP 180 LLPVTLHTEK GEPEGGYRTK HSSEVETDLF IGLPVARP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 5f28_C | 1e-17 | 1 | 72 | 1 | 72 | MEF2C |
| 5f28_D | 1e-17 | 1 | 72 | 1 | 72 | MEF2C |
| 6byy_A | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6byy_B | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6byy_C | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6byy_D | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6bz1_A | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6bz1_B | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6bz1_C | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6bz1_D | 9e-18 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
| 6c9l_A | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 9e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00110227001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009107040.1 | 1e-142 | PREDICTED: MADS-box protein AGL71 isoform X3 | ||||
| Refseq | XP_009107045.1 | 1e-142 | PREDICTED: MADS-box protein AGL71 isoform X3 | ||||
| Refseq | XP_009107050.1 | 1e-142 | PREDICTED: MADS-box protein AGL71 isoform X3 | ||||
| Swissprot | Q9LT93 | 1e-105 | AGL71_ARATH; MADS-box protein AGL71 | ||||
| TrEMBL | A0A3P6CUS8 | 1e-152 | A0A3P6CUS8_BRACM; Uncharacterized protein | ||||
| STRING | Bra028283.1-P | 1e-124 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.3 | 1e-106 | AGAMOUS-like 71 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




