![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00112174001 | ||||||||
| Common Name | GSBRNA2T00112174001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 77aa MW: 9004.27 Da PI: 7.7032 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30 | 1.2e-09 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+ +eE++l + +k+ G + W++Ia +++ gRt+ ++ +w
GSBRNA2T00112174001 33 MNQEEEDLVRRMHKLVGDR-WELIAGRIP-GRTAAEIERFW 71
679**************99.*********.********999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 5.1E-4 | 29 | 75 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.86E-6 | 32 | 71 | No hit | No description |
| SuperFamily | SSF46689 | 1.01E-7 | 34 | 73 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.1E-11 | 34 | 72 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.5E-8 | 34 | 72 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MDKHLRTKQT KTNPMLTSSS EEVSSLEWQA VNMNQEEEDL VRRMHKLVGD RWELIAGRIP 60 GRTAAEIERF WVMKYN* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.25129 | 1e-36 | flower | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaf epidermal cells, stomate guard cells in leaves, cotyledons and hypocotyls, inflorescences, developing seeds and siliques. {ECO:0000269|PubMed:18305006}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00112174001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519522 | 4e-70 | AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009134506.1 | 3e-50 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_013628635.1 | 3e-50 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_013681332.1 | 3e-50 | MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_013740775.1 | 3e-50 | MYB-like transcription factor ETC3 isoform X1 | ||||
| Swissprot | Q9M157 | 4e-31 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
| TrEMBL | A0A0D3B928 | 8e-49 | A0A0D3B928_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A398A5I8 | 8e-49 | A0A398A5I8_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6B7G6 | 8e-49 | A0A3P6B7G6_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4C9R2 | 8e-49 | M4C9R2_BRARP; Uncharacterized protein | ||||
| STRING | Bra000941.1-P | 1e-49 | (Brassica rapa) | ||||
| STRING | Bo3g054440.1 | 1e-49 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01060.2 | 4e-34 | CAPRICE-like MYB3 | ||||




