![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00113232001 | ||||||||
| Common Name | GSBRNA2T00113232001, LOC106422224 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 78aa MW: 8971.19 Da PI: 6.5204 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.4 | 9e-10 | 33 | 72 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
++ +eE++l + +k+ G + W++Ia +++ gRt+ ++ +w
GSBRNA2T00113232001 33 NMNQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAQEIERFW 72
6789**************99.*********.********999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 6.1E-4 | 30 | 77 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.72E-6 | 33 | 72 | No hit | No description |
| Pfam | PF00249 | 2.5E-8 | 35 | 73 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.72E-7 | 35 | 73 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.9E-11 | 36 | 73 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MDKHLRTKQT KTSPIVASSS SQEVSSIEWE ALNMNQEEED LVCRMHKLVG DRWELIAGRI 60 PGRTAQEIER FWVMKNN* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.25129 | 4e-40 | flower | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaf epidermal cells, stomate guard cells in leaves, cotyledons and hypocotyls, inflorescences, developing seeds and siliques. {ECO:0000269|PubMed:18305006}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00113232001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LC142708 | 2e-59 | LC142708.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-mizore. | |||
| GenBank | LC142709 | 2e-59 | LC142709.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-nishiki. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013619456.1 | 2e-51 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Refseq | XP_013718492.1 | 2e-51 | MYB-like transcription factor ETC3 isoform X1 | ||||
| Swissprot | Q9M157 | 2e-29 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
| TrEMBL | A0A0D3AS69 | 4e-50 | A0A0D3AS69_BRAOL; Uncharacterized protein | ||||
| STRING | Bo2g098940.1 | 6e-51 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01060.2 | 5e-32 | CAPRICE-like MYB3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106422224 |




