PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00117589001

Common Name

GSBRNA2T00117589001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 123aa MW: 13222.8 Da PI: 6.4934

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00117589001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.3	4.8e-10	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g WT+eEd +++ +v+ +G g+W++I+++ g GSBRNA2T00117589001 14 KGHWTAEEDAKILTYVAIHGVGNWSLIPKKAG 45 789**************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.0E-13	5	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.539	9	58	IPR017930	Myb domain
SuperFamily	SSF46689	2.22E-11	11	72	IPR009057	Homeodomain-like
SMART	SM00717	0.0017	13	52	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-8	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	1.55E-7	17	54	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
MGRPPCCDKS NVKKGHWTAE EDAKILTYVA IHGVGNWSLI PKKAGFESMW KERFSPHEEE 60 LIIQCHRIIG SSGTTSSCSS SSSSSLSINQ GAQAPDTTFC WSDFLLSDPV SPMSSQTQVV 120 GS*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During anther development, first confined to meiocytes, tapetal and middle layer cells. At the microspore stage, mainly expressed in the tapetum and microspores. Later observed in developing pollen grains. {ECO:0000269\|PubMed:18397379, ECO:0000269\|PubMed:21957980}.
Uniprot	TISSUE SPECIFICITY: Inflorescences-specific (PubMed:18397379). Accumulates in anthers, especially in tapetum and meiocytes/microsporocytes and microspores during anther development (PubMed:17666023, PubMed:18397379). {ECO:0000269\|PubMed:17666023, ECO:0000269\|PubMed:18397379}.

Functional Description ? help Back to Top
Source	Description
UniProt	Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269\|PubMed:18397379, ECO:0000269\|PubMed:21957980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00117589001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519591	1e-52	AY519591.1 Arabidopsis thaliana MYB transcription factor (At3g28470) mRNA, complete cds.
GenBank	DQ446711	1e-52	DQ446711.1 Arabidopsis thaliana clone pENTR221-At3g28470 myb family transcription factor (At3g28470) mRNA, complete cds.
GenBank	DQ653114	1e-52	DQ653114.1 Arabidopsis thaliana clone 0000017443_0000012156 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018477416.1	4e-33	PREDICTED: transcription factor MYB35
Swissprot	Q9LSI7	1e-30	MYB35_ARATH; Transcription factor MYB35
TrEMBL	A0A3P6DSH2	1e-84	A0A3P6DSH2_BRAOL; Uncharacterized protein
STRING	Bo2g146330.1	2e-70	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28470.1	5e-31	MYB family protein

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Tsugama D, et al. A putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus officinalis. Sci Rep, 2017. 7: p. 41497 [PMID:28176806] Lou Y, et al. Positive regulation of AMS by TDF1 and the formation of a TDF1-AMS complex are required for anther development in Arabidopsis thaliana. New Phytol., 2018. 217(1): p. 378-391 [PMID:28940573] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]