 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
GSBRNA2T00118568001 |
| Common Name | GSBRNA2T00118568001 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
| Family |
M-type_MADS |
| Protein Properties |
Length: 93aa MW: 10572.4 Da PI: 10.7476 |
| Description |
M-type_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| GSBRNA2T00118568001 | genome | Genoscope | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 53.9 | 2.2e-17 | 9 | 57 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien rqvtfskRrn ++KKA+ELS LC+++ i+fs+t k+y +ss
GSBRNA2T00118568001 9 KKIENVNSRQVTFSKRRNRLIKKANELSFLCEVD--KIVFSNTVKVYYFSS 57
68*****************************766..699********9986 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Later observed in sporogenous tissue of anthers. During male gametogenesis, expressed in the microspores before they separate from each other. Later present at high levels within pollen grains up to stage 13 of flower development, when anthers dehisce. During carpel development, first detected in developing ovules. After fertilization, confined to globular structures or nodules of proliferating free nuclear endosperm required for embryo development. Disappears from the endosperm at to the heart stage of embryo development, when very little nuclear endosperm remains. Never detected in developing embryos at any stage. In young seedlings, present everywhere except in a portion of the hypocotyl and in newly emerging leaves. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:17521410}. |
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in pollen, roots, flowers and siliques, and to a lower extent, in stems and leaves. Expressed in the endosperm and in developing male and female gametophytes. Also present in seedlings. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. |