PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122637001
Common NameGSBRNA2T00122637001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 118aa    MW: 13873 Da    PI: 9.316
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122637001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.4e-201461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  GSBRNA2T00122637001 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                         89********************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002498.3E-191461IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-221589IPR009057Homeodomain-like
CDDcd001671.83E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-66589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEHIIVK FHSVLGNRYD FFIYHLSYGH NIFCTFHFLG CRKLMID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-161489781B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During anther development, expressed from stage 4 to stage 6 in microsporocytes and tapetal cells. At the tetrad stage, expressed predominantly in tapetal cells. During microgametogenesis, expression decreases radically in the tapetum and microspores. {ECO:0000269|PubMed:21957980}.
UniprotTISSUE SPECIFICITY: Expressed in the tapetum and middle layer of developing anthers (PubMed:10353220). Expressed in trichomes (PubMed:12848824). {ECO:0000269|PubMed:10353220, ECO:0000269|PubMed:12848824}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122637001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893781e-106AC189378.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049H14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864431.12e-63cytochrome c oxidase assembly protein COX15
SwissprotQ9XHV03e-61MYB80_ARATH; Transcription factor MYB80
TrEMBLA0A078FYG37e-64A0A078FYG3_BRANA; BnaA02g28360D protein
STRINGAl_scaffold_0008_20496e-63(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-63myb domain protein 103
Publications ? help Back to Top
  1. Li SF,Iacuone S,Parish RW
    Suppression and restoration of male fertility using a transcription factor.
    Plant Biotechnol. J., 2007. 5(2): p. 297-312
    [PMID:17309685]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Qian H, et al.
    Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis.
    Ecotoxicology, 2015. 24(1): p. 163-71
    [PMID:25348600]
  4. Xiong SX, et al.
    The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana.
    Plant J., 2016. 88(6): p. 936-946
    [PMID:27460657]
  5. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]
  6. Li DD,Xue JS,Zhu J,Yang ZN
    Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 1559
    [PMID:28955355]