![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00126659001 | ||||||||
| Common Name | GSBRNA2T00126659001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 143aa MW: 16138.2 Da PI: 4.7941 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 36.4 | 1.1e-11 | 16 | 72 | 5 | 61 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
++ +r+ +NRe+ArrsR +K++ ++ L+ v +L+++N + ++ ++++ ++++
GSBRNA2T00126659001 16 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNQLKEQNNEILTSVSITTQHYLTVEA 72
7889**********************************9887777766666666555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 5.0E-10 | 9 | 59 | No hit | No description |
| SMART | SM00338 | 4.7E-17 | 12 | 76 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.14 | 14 | 77 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 6.6E-9 | 15 | 57 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 4.98E-12 | 16 | 68 | No hit | No description |
| CDD | cd14702 | 1.51E-18 | 17 | 67 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 19 | 34 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009744 | Biological Process | response to sucrose | ||||
| GO:0080149 | Biological Process | sucrose induced translational repression | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MDPSSSGSEE SLMEQRKRKR MLSNRESARR SRMKKQKLLD DLTAQVNQLK EQNNEILTSV 60 SITTQHYLTV EAENSVLKAQ LDELSHRLES LNGIIEFLES TNGTCPNPLT GPEPDDFLVN 120 QMNMNMFCMN QPLMASSDAL LY* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 15 | 36 | RKRKRMLSNRESARRSRMKKQK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.4166 | 1e-156 | flower| leaf| seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00470 | DAP | Transfer from AT4G34590 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00126659001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189529 | 1e-116 | AC189529.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB092P05, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009108720.2 | 1e-101 | PREDICTED: bZIP transcription factor 11-like | ||||
| Swissprot | O65683 | 5e-73 | BZP11_ARATH; bZIP transcription factor 11 | ||||
| TrEMBL | A0A397YID6 | 2e-99 | A0A397YID6_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4F0P4 | 2e-99 | M4F0P4_BRARP; Uncharacterized protein | ||||
| STRING | Bra034639.1-P | 1e-100 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM501 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G34590.1 | 3e-67 | G-box binding factor 6 | ||||




