![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00126814001 | ||||||||
| Common Name | GSBRNA2T00020469001, GSBRNA2T00020472001, GSBRNA2T00126814001, GSBRNA2T00126815001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 78aa MW: 8763.1 Da PI: 10.6745 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 100.5 | 1.1e-31 | 21 | 76 | 5 | 60 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
+ cprC+s+ntkfCyy n slsqPry Ck+C r Wt+G alrn+P+G+g rk k+
GSBRNA2T00126814001 21 PRICPRCNSDNTKFCYYTNSSLSQPRYICKNCLRLWTHGKALRNIPIGSGGRKTKR 76
567**************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-19 | 19 | 76 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 24.642 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 7.3E-28 | 23 | 76 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MNTSHVFVSA NHQVNGEKPP PRICPRCNSD NTKFCYYTNS SLSQPRYICK NCLRLWTHGK 60 ALRNIPIGSG GRKTKRI* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.11231 | 1e-123 | seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00126814001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006413832.1 | 1e-36 | dof zinc finger protein DOF4.4 | ||||
| Swissprot | Q9SUA9 | 4e-30 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
| TrEMBL | A0A078CGR7 | 1e-50 | A0A078CGR7_BRANA; BnaC03g64450D protein | ||||
| TrEMBL | A0A397YA53 | 1e-50 | A0A397YA53_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6BKN8 | 1e-50 | A0A3P6BKN8_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4DWI6 | 1e-50 | M4DWI6_BRARP; Uncharacterized protein | ||||
| STRING | Bra020880.1-P | 2e-51 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM21512 | 2 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21050.1 | 1e-32 | Dof-type zinc finger domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




