![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00127685001 | ||||||||
| Common Name | GSBRNA2T00127685001, WRKY45.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 145aa MW: 16766.8 Da PI: 9.8587 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 102.4 | 2.7e-32 | 65 | 123 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r + d+ vv++tY+g H+h+
GSBRNA2T00127685001 65 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEKGCRVKKQVQRLSGDEGVVVTTYQGVHTHP 123
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.8E-34 | 50 | 123 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.14E-29 | 57 | 124 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.871 | 60 | 125 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.4E-37 | 65 | 124 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.2E-26 | 66 | 123 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006817 | Biological Process | phosphate ion transport | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008134 | Molecular Function | transcription factor binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MEDRSCQVLF PSSSVDHRLS GDQTQINTSS SLQQHNTNKE EKHKSKKKER EARFAFQTRS 60 QVDILDDGYR WRKYGQKAVK NNPFPRSYYK CTEKGCRVKK QVQRLSGDEG VVVTTYQGVH 120 THPVDTPSDN FHHILTQMHI FPPF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-28 | 55 | 128 | 7 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-28 | 55 | 128 | 7 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.27860 | 2e-98 | seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00325 | DAP | Transfer from AT3G01970 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00127685001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC246580 | 0.0 | KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009124053.1 | 1e-106 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Refseq | XP_013583917.1 | 1e-106 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Refseq | XP_022575702.1 | 1e-106 | probable WRKY transcription factor 45 | ||||
| Swissprot | Q9S763 | 2e-68 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
| TrEMBL | A0A0D3CNB1 | 1e-105 | A0A0D3CNB1_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A397ZGD6 | 1e-105 | A0A397ZGD6_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4FHH9 | 1e-105 | M4FHH9_BRARP; Uncharacterized protein | ||||
| TrEMBL | V9LYL2 | 1e-105 | V9LYL2_BRANA; WRKY transcription factor 45.1 | ||||
| STRING | Bra040557.1-P | 1e-105 | (Brassica rapa) | ||||
| STRING | Bo5g153870.1 | 1e-105 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01970.1 | 1e-69 | WRKY DNA-binding protein 45 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




