![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00128824001 | ||||||||
| Common Name | GSBRNA2T00128824001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 135aa MW: 14620.2 Da PI: 4.5479 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 86.8 | 2.5e-27 | 25 | 84 | 38 | 97 |
NF-YB 38 cvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
+e is+vt++asdk+ +ekrkt+ngddllw+++tlGfedyveplkvyl+ +re+ege+
GSBRNA2T00128824001 25 QDTELISLVTGKASDKSLKEKRKTVNGDDLLWSMTTLGFEDYVEPLKVYLQGFREIEGER 84
5689******************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00615 | 1.2E-12 | 22 | 40 | No hit | No description |
| SuperFamily | SSF47113 | 9.07E-18 | 26 | 93 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.3E-21 | 27 | 87 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.0E-5 | 28 | 58 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.2E-12 | 41 | 59 | No hit | No description |
| PRINTS | PR00615 | 1.2E-12 | 60 | 78 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MGDSDRDSGG GQTRNGKSPL SPREQDTELI SLVTGKASDK SLKEKRKTVN GDDLLWSMTT 60 LGFEDYVEPL KVYLQGFREI EGERTGLGRP QTGGEGGEHL RDAVGGDGDG LYGGVLEYQF 120 RLVQCIVFWL AYSG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-19 | 23 | 79 | 37 | 93 | NF-YB |
| 4awl_B | 2e-19 | 23 | 79 | 38 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-19 | 23 | 79 | 38 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00128824001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013697087.1 | 2e-49 | nuclear transcription factor Y subunit B-2-like | ||||
| Swissprot | Q9FGJ3 | 1e-42 | NFYB2_ARATH; Nuclear transcription factor Y subunit B-2 | ||||
| TrEMBL | A0A0D3D9X0 | 2e-84 | A0A0D3D9X0_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g077790.1 | 3e-85 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47640.1 | 2e-44 | nuclear factor Y, subunit B2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




