![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00129904001 | ||||||||
| Common Name | GSBRNA2T00129904001, LOC106431908, WRKY75-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 148aa MW: 17086 Da PI: 9.6483 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.3 | 6.4e-33 | 67 | 125 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt+agC+vkk+v+r ++d++vv++tYeg H h
GSBRNA2T00129904001 67 LDDGYRWRKYGQKAVKNNTFPRSYYRCTYAGCNVKKQVQRLTSDQEVVVTTYEGVHSHA 125
59********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 9.8E-34 | 52 | 125 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.62E-29 | 59 | 125 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.849 | 62 | 127 | IPR003657 | WRKY domain |
| SMART | SM00774 | 9.8E-38 | 67 | 126 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.6E-26 | 68 | 124 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0010055 | Biological Process | atrichoblast differentiation | ||||
| GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
| GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MEGYQNGSSY APFLSLTSHQ NHSKLEFHQG EEEASKVREG SSRSLEVKKK GKKQRFAFQT 60 RSQVDILDDG YRWRKYGQKA VKNNTFPRSY YRCTYAGCNV KKQVQRLTSD QEVVVTTYEG 120 VHSHAIEKST ENFEHILTQM QIYSSFN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 8e-30 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 8e-30 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.29080 | 0.0 | leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00506 | DAP | Transfer from AT5G13080 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00129904001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU912417 | 0.0 | EU912417.1 Brassica napus WRKY75-1 transcription factor (WRKY75-1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009131315.1 | 1e-107 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Refseq | XP_013728203.1 | 1e-107 | probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 4e-79 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A397ZS07 | 1e-106 | A0A397ZS07_BRACM; Uncharacterized protein | ||||
| TrEMBL | C4N0Y0 | 1e-106 | C4N0Y0_BRANA; WRKY75-1 transcription factor | ||||
| TrEMBL | M4CPN9 | 1e-106 | M4CPN9_BRARP; Uncharacterized protein | ||||
| STRING | Bra006178.1-P | 1e-107 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 2e-81 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 106431908 |




