PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131141001
Common NameGSBRNA2T00131141001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 68aa    MW: 7601.95 Da    PI: 9.7781
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131141001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.62.2e-111657142
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
                         rg+W+ +Ed++l+  ++++G ++W++ ++  g+ R++ +c++
  GSBRNA2T00131141001 16 RGPWSYDEDLKLISFIQKYGHKNWRSLPNQAGLLRCGMSCRL 57
                         89******************************99******95 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-16756IPR009057Homeodomain-like
PROSITE profilePS5129410.0671162IPR017930Myb domain
SuperFamilySSF466898.61E-111156IPR009057Homeodomain-like
PfamPF002495.0E-101657IPR001005SANT/Myb domain
CDDcd001671.13E-61857No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS YDEDLKLISF IQKYGHKNWR SLPNQAGLLR CGMSCRLLDG  60
LITSDLM*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}.
UniprotTISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131141001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934598e-74AB493459.1 Arabidopsis thaliana At1g16490 mRNA for hypothetical protein, partial cds, clone: RAAt1g16490.
GenBankAY0854618e-74AY085461.1 Arabidopsis thaliana clone 152630 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648753.12e-37transcription factor MYB58-like
RefseqXP_022545677.12e-37transcription factor MYB58-like
SwissprotQ9SA472e-33MYB58_ARATH; Transcription factor MYB58
TrEMBLA0A0D3A1823e-42A0A0D3A182_BRAOL; Uncharacterized protein
STRINGBo1g003590.14e-43(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.17e-36myb domain protein 58
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  3. Noda S, et al.
    The expression of a rice secondary wall-specific cellulose synthase gene, OsCesA7, is directly regulated by a rice transcription factor, OsMYB58/63.
    Planta, 2015. 242(3): p. 589-600
    [PMID:26070439]
  4. Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y
    Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.
    J. Plant Res., 2018. 131(2): p. 297-305
    [PMID:28921082]